技术展望2023：当原子遇见比特--埃森哲（英文）VIP专享VIP免费

下载本文档

阅读 760
格式 pdf
大小 22.27 MB
约115页
2023-06-05
收藏
点赞(0)
海报
举报

Technology Vision 2023

When Atoms meet Bits

e foundations of our new reali

From insights to action, the path to extraordinary value starts here.

Introduction | Digital identity | Your data, my data, our data | Generalizing AI | Our forever frontier 2

#TechVisionTechnology Vision 2023 | When Atoms meet Bits

While standing at the edge of the next great

technological era, enterprises must navigate economic

and geopolitical uncertainty. The natural inclination of

many organizations is to pull back. We have a different

perspective. Now more than ever is the time for leaders

to lean into strategies powered by technology to create

differentiation. In fact, 10 years ago we predicted every

business is a digital business, and this could not be

more accurate today.

We’ve talked about the ve key forces of change

that companies must harness over the next decade,

including the need for total enterprise reinvention.

Cloud, AI, and the metaverse, in particular, have

accelerated to such degrees that they dramatically

speed up change, bend the innovation curve and

create more and more value for every business

and organization.

Foreword

Businesses must embrace the foundations of our new reali

Yet our research shows that only 8% of companies

are adopting a strategy of total enterprise reinvention.

These are the Reinventors, and we believe every

company must aspire to be one. Among that

backdrop, our Technology Vision provides insights

to enable leaders and their organizations to act now

to embrace technology and use the foundations of a

new reality as a path towards reinvention.

With this vision, we examine our movement between

two types of worlds, physical and digital. Over

the years, enterprises and individuals have taken

many steps to create their presence in the digital

space, consciously moving back and forth between

physical reality and the digital ones they created.

We believe the time has come to change that. The

next wave of business transformation will erase the

demarcation between those worlds to fuse them

into a new reality.

The goal is not incremental improvement, but a step

change towards total reinvention. Not everyone may

be ready for this change, but leaders must prepare

now for the future where the movement between

worlds is seamless and often simultaneous.

We look forward to sharing our latest Technology

Vision and building the foundations of a new reality

with you.

Technology is the answer. The time is now.

Julie Sweet

Chief Executive Ofcer

Paul Daugherty

Group Chief Executive -

Technology & Chief Technology Ofcer

Contents

Digital identity

ID for everyone

and everything

22 - 40

Your data,

my data, our data

Why transparency

will become your most

precious resource

41 - 59

Generalizing AI

e radical edges—

and possibilities—

of intelligence

60 - 80

Our forever

frontier

e big bang of computing

and science

81 - 101

Technology Vision 2023 | When Atoms meet Bits #TechVision

Introduction | Digital identity | Your data, my data, our data | Generalizing AI | Our forever frontier

/115

下载本文档

文本预览下载提示常见问题

TechnologyVision2023WhenAtomsmeetBitsThefoundationsofournewrealityFrominsightstoaction,thepathtoextraordinaryvaluestartshere.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier2#TechVisionTechnologyVision2023WhenAtomsmeetBitsWhilestandingattheedgeofthenextgreattechnologicalera,enterprisesmustnavigateeconomicandgeopoliticaluncertainty.Thenaturalinclinationofmanyorganizationsistopullback.Wehaveadifferentperspective.Nowmorethaneveristhetimeforleaderstoleanintostrategiespoweredbytechnologytocreatedifferentiation.Infact,10yearsagowepredictedeverybusinessisadigitalbusiness,andthiscouldnotbemoreaccuratetoday.We’vetalkedaboutthefivekeyforcesofchangethatcompaniesmustharnessoverthenextdecade,includingtheneedfortotalenterprisereinvention.Cloud,AI,andthemetaverse,inparticular,haveacceleratedtosuchdegreesthattheydramaticallyspeedupchange,bendtheinnovationcurveandcreatemoreandmorevalueforeverybusinessandorganization.ForewordBusinessesmustembracethefoundationsofournewrealityYetourresearchshowsthatonly8%ofcompaniesareadoptingastrategyoftotalenterprisereinvention.ThesearetheReinventors,andwebelieveeverycompanymustaspiretobeone.Amongthatbackdrop,ourTechnologyVisionprovidesinsightstoenableleadersandtheirorganizationstoactnowtoembracetechnologyandusethefoundationsofanewrealityasapathtowardsreinvention.Withthisvision,weexamineourmovementbetweentwotypesofworlds,physicalanddigital.Overtheyears,enterprisesandindividualshavetakenmanystepstocreatetheirpresenceinthedigitalspace,consciouslymovingbackandforthbetweenphysicalrealityandthedigitalonestheycreated.Webelievethetimehascometochangethat.Thenextwaveofbusinesstransformationwillerasethedemarcationbetweenthoseworldstofusethemintoanewreality.Thegoalisnotincrementalimprovement,butastepchangetowardstotalreinvention.Noteveryonemaybereadyforthischange,butleadersmustpreparenowforthefuturewherethemovementbetweenworldsisseamlessandoftensimultaneous.WelookforwardtosharingourlatestTechnologyVisionandbuildingthefoundationsofanewrealitywithyou.Technologyistheanswer.Thetimeisnow.JulieSweetChiefExecutiveOfficerPaulDaughertyGroupChiefExecutive-Technology&ChiefTechnologyOfficerContentsDigitalidentityIDforeveryoneandeverything22-40Yourdata,mydata,ourdataWhytransparencywillbecomeyourmostpreciousresource41-59GeneralizingAITheradicaledges—andpossibilities—ofintelligence60-80OurforeverfrontierThebigbangofcomputingandscience81-1013TechnologyVision2023WhenAtomsmeetBits#TechVisionIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier#TechVisionTechnologyVision2023WhenAtomsmeetBitsTechnologyVision2023Whenweshop,weeithergointoastoreorpullupawebpage.Weworkinpersonorremote.Wecollaboratewithpeopleandcomputers,butusuallynotatthesametime.Weliveourlivessplitbetweenthedigitalandthephysical,and,frankly,movingacrosstheseseparaterealitiesisexhaustingandinefficient.Transitioningbetweenthemcanbechallenging,confusing,orimpossible,andwhileitcanbeeasiertofocusonjustoneortheother,doingsoisfundamentallylimiting.So,it’stimetochangethat.Thenextwaveofbusinesstransformationwillshiftfromcreatingisolateddigitalcapabilitiestocreatingthefoundationsofanewreality—asharedrealitythatseamlesslyconvergesthephysicalliveswe’vebeenleadingwiththedigitaloneswe’vebeenrapidlyexpanding.Thegoalisnotincrementalimprovement,butastepchange.Anonlinestorehereorasmarterobjecttheremayhavebeengoodenoughinthepast,butwearenowrealizingthatthetruevalueofcombiningdigitalandphysicaltogethergoesmuchfurther.LookatgenerativeAI.InterestingenerativeAIissurging,withnewtoolscapturingtheworld’sattentionfasterthananyotherrecenttechnology.Buthowpeopleareusingthemrightnow—tocreatedigitalimagesandcontent—isjustthebeginning.Wecanalreadyseethatthistechnologyispoisedtoshapethefutureofscience,enterprisedata,howwedesignandmanufactureproducts,andsomuchmore.WhenAtomsmeetBits:ThefoundationsofournewrealityWeliveintwoparallelrealities,oneofatomsandoneofbits.4IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontierIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier5#TechVisionTechnologyVision2023WhenAtomsmeetBitsIsitchallenging?Yes.ButevenatatimewhentheworldfacesanuncertaineconomicclimateandisstillintheshadowofrecoveryfromCOVID-19,weareseeingenterprisesmakesomeoftheirmostambitiousbetsyet.Theyarefuelinganewwaveofdigital-physicalconvergencethat’spushingusclosertoaseamlesslysharedreality—leveragingthebestofatomsandbitstodrivenovelpossibilties.Inhealthcare,thissharedrealityispushingustowardspersonalizedcare.WithfundingfromtheEuropeanUnion,aconsortiumofhospitals,researchers,andstartupshavejoinedtheNeurotwinproject,anefforttobuilddigitaltwinsofindividualhumanbrains.1,2Eachtwinwouldbeusedtohelphealthcareprovidersunderstandandpredicttriggersforneurologicaldiseasesandimprovepreventativeinterventions.TheprojectissettolaunchtwostudiesonindividualssufferingfromAlzheimer’sandepilepsyin2023.3Evenproblemsasbigassustainabilityarebeingre-examinedthroughthelensofwhatwecandowhenwecombinephysicalsciencesanddigitaltechnology.In2022,ABInBevexpandedproductionofexecutivesagreethattheconvergenceofdigitalandphysicalworldsoverthenextdecadewilltransformtheirindustry.96%facilitiesforitsbarleyupcyclingcompany,EverGrain,whichusestechnologyandsciencetofindnewapplicationsforbyproductsofthebeer-makingprocess.4,5Thecompanycreatedanewbarleymilk-basedcoffeedrinkwithAirshipCoffee,isdevelopingsnackswithbarley-basedingredientswithPostHoldings,andevendevelopedbarleystraw-basedpackagingforCorona,turningatraditionallydiscardedbyproductintopaperboardboxesthattake90%lesswatertofabricate.6,7,8Butnoteveryoneisreadyforthisstepchange.Formanyyearstheguidingpillarofenterpriseinnovationhasbeentakingprocesses,evenwholepartsoftheorganization,anddigitizingthem—fromhowthefactoryfloorisrun,toloyaltyprograms,advertising,supplychains,andrecentlytheentireworkforce.Forpeople,thestoryhasbeennodifferent.Peoplehavespentyearsbuildingadigitallife:fromhowwedoourbanking,toestablishingourselvesonsocialmedia,tochoosingstreamingovercable—whichtherelativemajorityofTVwatchersdidforthefirsttimethispastsummer.9IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier6#TechVisionTechnologyVision2023WhenAtomsmeetBitsWhilewehavebuiltarichandmeaningfuldigitalworld,wehaven’treallyreconcileditwiththephysicalone.Challengeswithdigitalidentityanddatainteroperabilityleavepeopleoverwhelmedwithtechnologyandexposedtonewdimensionsoffraudandrisk.Manyenterpriseswatchedtheirentireworkforcegodigitalandarenowsufferingattritionastheystruggletofigureouthowtohybridizearemoteworkforce.Wehaven’tevenreallyaccountedforthedirectimpactourdigitaleffortshavehadonthephysicalworld,likehowanestimatedfivebillionmobilephoneswillbethrownoutin2022alone,orhowforallofcloudcomputing’sefficiencybenefits,ithassurpassedcommercialairlinesinitscontributionstoglobalCO2emissions.10,11Givenhowdisconnectedanddisjointedourdigitalandphysicalworldscanfeel,it’snowonderthatthenextdecadeofinnovativeeffortsisstartingtobedefinedbyhowwefusethetwotogether.Thefoundationsofthisnewrealityarealreadybeingputinplace,sothetimetomakeyourownmarkisnow.Lastyear,inAccenture’s2022TechnologyVision,wecalledouttheMetaverseContinuumasthenextbigstepafterdigitaltransformation.Thoughsomemayseethemetaverseastheculminationofthelastwaveofdigitaldisruption,it’sbetterviewedasthebeginningofthenext.Themetaverseisawatershedmomentfortheconvergenceofatomsandbits,acceleratingthepathtoasingularsharedreality.Acrossthemetaversecontinuumwearemakingthedigitalworldbehavemorelikehowweexperiencethephysical,andconverselyweareusingmetaversetechnologiestoreimaginewhatwedointhephysicalworld.Itisthenexusbetweendigitalandphysical—whichiswhysomeofthemostpowerfulwayswehaveseenthemetaverseusedarewaysinwhichwefusethetwo.Forexample,theveryfirst3D-printedsteelbridgeintheworldwasbuiltinAmsterdamandwasdesignedwiththiskindofdigital-physicalhybridizationinmind.12Notonlywasthebridgecreatedwith3D-printingandroboticarms,butitwasalsodesignedspecificallytocoexistwithadigitaltwin.Itwasembeddedwithacutting-edgesensornetworkthatnowfeedsadigitaltwinwithreal-timedataonvibration,strain,weatherconditions,andmore.Thetwincanpredicthowthebridgewillbehave,suchGivenhowdisconnectedanddisjointedourdigitalandphysicalworldscanfeel,it’snowonderthatthenextdecadeofinnovativeeffortsisstartingtobedefinedbyhowwefusethetwotogether.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier7#TechVisionTechnologyVision2023WhenAtomsmeetBits#TechVisionTechnologyVision2023WhenAtomsmeetBitsthatmaintenanceneedscanbequicklyresolvedandengineerscanbetterunderstandhow3D-printedsteelmightbeusedinfutureprojects.Othercompaniesareendeavoringtothreaddigitalbackintophysical.GooglehasbeenslowlyintegratinganewwayfindingfeatureintoGoogleMapscalledLiveView.Itcreatesanoverlayofdetailsabout,ordirectionsaround,users’environmentsviageolocatorsandsmartphonecameras.13AndSnaphasbeenexpandingitsARtechnologyfarbeyondfilters,partneringwithcompanieslikeAmazon,Puma,andRalphLaurentointegrate3Dproductmodelingandaugmentedrealitytry-onfeaturesintotheshoppingexperience.14,15Thisblurringofthedigital-physicalboundaryisnowexposingnewmodesofcommerce:thecompanyisrollingoutanew“DressUp”featurewhereuserscandiscover,tryon,andshopfornewproductsdirectlyintheapp,andthecompanyreported250millionpeoplehaduseditsARshoppinglensesoverfivebilliontimesinjustoneyearalone.Whilethebuddingmetaversecontinuumisthemostattention-grabbingfrontieronthepathtoournewreality,it’shardlytheonlyone.OpenAIopen-sourcedoneofthemostpowerfulAutomaticSpeechRecognition(ASR)neuralnetworks,calledWhisper,whichwastrainedonnearly700,000hoursofspeech-relateddataandapproacheshuman-likelevelsofaccuracy.16ASRandnaturallanguageprocessingarefusingthedigitalandphysicalbydoingawaywithtoday’sabstractionslikekeyboardsandgesturesandallowingpeopletoengagethedigitalworldinoneofthemosthumanwayspossible:speech.Orconsiderthegrowingtrendofcobots(collaborativerobots),amarketthatissettoexpandto$16.3billionby2028.17Thesemachinesletthepowerofmachineintelligenceandautomationbleedintothephysicalworld,allowingpeopletoworkmorenaturallyandunearthnewefficiencies.Inoneexample,Moxi,acobotdesignedforhospitals,wasabletosavehealthcareworkersatonehospital3,200hoursbytakingcareofroutinetaskslikedeliveriesandallowingthestafftospendmoretimegivingcaretopatients.18...whatbecomesclearisthatmergingdigitalandphysicalisthepathtotrulynewpossibilities.We’vearrivedatanexcitingfrontieroftechnologyinnovationforbusinesses,onewherewe’renotjustdigitizingbutstartingtoputthatdigitalfoundationtowork.Fusingdigitalandphysicalisnotonlygeneratingnewproductsandservices,it’stheforcebehindaneweraofscientificresearch.Leadersarecreatingthenextsetoftoolsanddisruptionspoisedtorewritehowtheworldworks.Andwhat’sbecomeclearisthatwhenatomsandbitscollide,trulynewpossibilitiesemerge.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier8#TechVisionTechnologyVision2023WhenAtomsmeetBitsThefoundationsofournewrealityTheconvergenceofourparallelrealitieswillevolveoverthenexttenyears.Enterpriseswillfirstfindopportunityfromitinspecific,narrowercircumstances.Itmightbeginasadigitaltwinforasinglebridge,aroboticsdeploymentinahospital,orpairingaproductdesignerwithgenerativeAI.Butastheseinnovationsproliferate,wewillseethemgrowintoentirelynewphysicalenvironments,newwaysofworkinginthemetaverse,andmore.Ultimately,thefusionofatomsandbitswilldisruptthefabricofourworlds,wherematerialsandlivingthingsareinterlacedwithtechnologyandtechnology’scapabilitiesexpandexponentially—leadingustoanewfrontier.2023TechnologyVision:#TechVisionTechnologyVision2023WhenAtomsmeetBits9IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontierThisyear’s2023TechnologyVisionexploresthetechnologytrendsdrivingthisnewreality,andthestepsenterpriseswillneedtotaketothriveinit.Wechartthepaththatbeginswithblurringphysicalanddigital,continuesthroughtheintractableproblemscompaniesarestartingtobeabletosolve,andconcludeswiththesciencetechnologyrevolutionthat’sbringingtruenoveltytobusinessesandtheworld.Indigitalidentitywediscusshowidentityisthequietcatalystofthisnextgenerationofinnovation.Ourbiggesttechnologicalambitionsarebeingheldbackbyoldmodelsofidentity.Thephysical-digitalconvergencewillonlybesparkedwhenpeopleandthingshaveidentitythatcantraversebothsides.AndemergingformsofdigitalIDarefinallybreakingdownthewallsthatdivideenterprisesandpeople’sphysicalanddigitallives,sparkingatorrentofchange.Yourdata,mydata,ourdataexploreshowtransparencywillbeapreciousresourceforenterpriseslookingtoleadthesechanges.Supplyanddemandfordataamongallenterprisestakeholdersisdramaticallyincreasing.Enterpriseswillneedtorethinktheirdatacollectionandarchitecturedesigntobeginexposingthedatathatmatters.Leadershaveanunprecedentedopportunitytobuildtrustwithpartnersandcustomersbyproactivelybecomingmoretransparent—orriskhavingsomeoneelsedoitforthem.Butthetaskofbuildingthisnewrealitywon’tjustbeforhumans.GeneralizingAIexploreshowanewcategoryofAI—spurredonbyfoundationmodelsandlargelanguagemodels—isbecomingtablestakesforanybusinessoperatingintomorrow’smarket.Withthesheervolumeofdataandinsightsneededtodrivesolutionsfortheproblemsenterprisesface,businessleaderswillneedtoleanonthefullcapabilitiesthatgenerativeAIandthenextgenerationofAIadvancesprovide.Andfinally,ourforeverfrontiergivesenterprisesawindowintowhatliesfartherdowntheline:thesciencetechnologyrevolution.Itexploreshowthefeedbackloopbetweenscienceandtechnologyisgettingfaster,witheachacceleratingtheadvancementoftheother,inwaysthatbegintounlocktheworld’sgrandchallenges.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier10#TechVisionTechnologyVision2023WhenAtomsmeetBitsIgnitingasciencetechnologyrevolutionistheinevitableresultofenterprisesbringingatomsandbitstogether.Asourdigitalandphysicalrealitiesconvergeintoonesharedreality,physicalscienceanddigitaltechnologyareincreasinglyusedtoamplifyoneanother,fundamentallyreshapingtheworldaroundus.Companiesalreadyhaveatechnologystrategythatencompassesmanagingtheirinformation(IT)andcontrollingtheirphysicalsystems(OT).Tofullyunlocktheopportunityofournewreality,enterprisesneedtoextendthatstrategytoathirddimension—ScienceTech(ST).FromITandOTtoSTBringingAtomsandBitstogether:IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier11#TechVisionTechnologyVision2023WhenAtomsmeetBitsTakeAlphaFold,arecentinnovationoutofDeepMind.WhileothereffortslikeAlphaGoandAlphaStarexploredAI’sabilitytowindifferenttypesofgames,AlphaFoldturnedtoafarmorepracticalandsignificantapplication:proteinfolding.19Proteinsarethebuildingblocksofbiology,andtheiruniquethree-dimensionalstructuresdeterminewhatfunctiontheywillperform.So,forinstance,ifapharmaceuticalcompanyweredevelopinganewdrug,understandingvariousproteinshapeswouldbecriticaltounderstandinghowthedrugwillinteractwiththepersonitisbeingadministeredto.Theproblemis,historically,theseareextremelylaborintensivetostudy,orcomputationallyintensivetosimulate.Butinthesummerof2022,DeepMindpubliclyreleasedadatabaseof200milliondifferentproteinstructures—whichcoversnearlyeveryproteinknowntohumanbeings—nowavailabletoallcompaniesandresearchersaroundtheworld.20Thetakeawaygoesbeyondproteinfolding.AlphaFoldunlockedagrandchallenge,andforenterpriseleadersinallindustries,thatsignalsabrand-newworldofpossibility.Thefieldofbiologyhasalwaysbeenlimitedbythetimeittooktoperformoperationsrelatedtoproteinfolding—arestrictioneliminatedbyAlphaFold.Intheshorttimesinceitscreation,AlphaFoldhasbecomeacriticaltoolinthefieldofbiology,acceleratingactivitieslikedrugdiscoveryandthestudyofnovelbacteriaandplantstructures,anddeepeningourunderstandingofdeadlydiseases.21Thisisthetruepowerofbringingscienceandtechnologytogether,notjustefficiencyorevenacceleration—buthowitcompletelyreframesthehorizonofpossibility,shatteringwhatwereonceconsideredinsurmountableconstraints.Leadersneedtoreorientaroundthismindsetshift.Itissubtle,butprofound.Whenenterprisesapproachdigitaltransformation,itisofteninwardlooking.Itisaboutdisruptingtheenterprise,itspartnerships,anditsrelationshiptothemarket,andevendemonstratingnewmodelstothemarketthatforceotherstoreact.Thefocusisongainingadvantageinthecompetitivelandscape.Butenterprisesthatlooktosciencetechnologyaregoingonestepbeyond:Theyaren’tgettingalegupinthesamecompetition,theyareredefiningtherulesofthegame.Asourdigitalandphysicalrealitiesconvergeintoonesharedreality,physicalscienceanddigitaltechnologyareincreasinglyusedtoamplifyoneanother,fundamentallyreshapingtheworldaroundus.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier12#TechVisionTechnologyVision2023WhenAtomsmeetBitsComputationalchemistryresearchersattheUniversityofNewMexicousedhighperformancecomputingtoaccomplishinjustfouryearsresearchthatwouldhavetaken7,257yearsonasinglelaptop.22Solugen,abiotechstartup,usedscienceandtechnologytodevelopanewmethodoffabricatingindustrialchemicalsoutofsugarinsteadoffossilfuels,andisalreadypartneringwithwatertreatmentproviders.23AndNokiaispartneringwithASTSpaceMobiletoenabledirect-to-cellphoneconnectivityfromspacetoruralorotherwiseunderservedcommunities.24Thisisthenextgenerationoftechnologydisruption—notjustdigitizingthepresentbutacceleratingtowardsapreviouslyunimaginablefuture.Thepathforwardwillbechallenging.Thereisnooneclearlydefinedtechnologytoinvestin.Thoughtherearesomelikelycontributorslikequantumcomputing,artificialintelligence,andextendedreality,thepointisthatthisgenerationofdisruptionisnolongeraboutdevisingatechnologystrategyalone,itisaboutdesigninganinnovationstrategythattargetsdigital-physicalconvergence.Thecompaniesthatsucceedwillfindthemselvesatthecenterofthesciencetechnologyrevolution,andforbetterorworse,enterprisesaren’thurtingforareastomaketheirplay.Thisisthenextgenerationoftechnologydisruption—notjustdigitizingthepresentbutacceleratingtowardsapreviouslyunimaginablefuture.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier13#TechVisionTechnologyVision2023WhenAtomsmeetBitsTakingactioninournewsharedrealityBecomingaleaderinbuildingasharedrealityandinvestinginthescienceandtechnologytoolstogetaheadofdisruptionarenosmalltasks.Understandably,everyenterpriseleadermightwonderwhattheimperativeis.Whytrytogetahead,andwhydoweneedtostartnow?GrandChallenges:IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier14#TechVisionTechnologyVision2023WhenAtomsmeetBitsThinkaboutsomeofthebiggestchallengesfacingenterprisestoday:agloballaborrealignment;supplychaindisruptions;misinformation;mountingpressurefromcustomersandgovernmentsformoresustainablesolutions;agrowingcyberthreatlandscape.Theseproblemsaretopofmindforeveryexecutive,butimportantly,theyarefundamentallydifferentfromtheproblemsofthepast.Thesearemassivelyinterlockedproblems,withnumerousdimensionsandamultitudeofdifferentpartnersandstakeholdersatplay.Portdelaysandlaborshortagesacrossthefoodserviceindustryareimpactingthebottomlineforfoodsuppliers.25,2652%ofcompanieshavesupplychainpartnersthathavebeenimpactedbyransomware.27Andenterprisesarepoisedtofeeltheimpactsofclimatechange,eveniftheyaremanagingtoavoidthemtoday.InAugust2022,forinstance,companiesinChina’sSichuanprovincewereforcedtoshutdownfactoriesmakingsolarpanels,cement,andmore,afteraworseningdroughtcausedhydropowerreservoirstorunlow.28Isitconceivablethatanyenterprisecouldsolveevenoneofthesealone?Ofcoursenot.Thisistheurgency.Theproblemsenterprisesaremostaffectedbytodayareonestheyarenotyetequippedtosolve.Yesterday’sstrategiesandtechnologiesareprovingtonotbeenoughtoovercomethegrandchallengesenterprisesarestartingtostaredown.Buildingasharedrealityofatomsandbitsisthenecessarypathtostarttacklingnewproblemsinnewways.Technologyhasalwaysrisentomeettheneedsofthetime,andnowthechallengeswefacearebiggerthananyonecompanyalone.It’stimetostartforgingthetoolstofixthem,together.Thinkaboutsustainability.Environmentalimpactisoneofthemostpressinggrandchallengesthatcompaniesandtheworldfacetoday,andincreasinglymorecompaniesareeagertobepartofthesolution.Thoughdespitetheireagerness,manyriskstillmissingtheirtargets.29Whensharedsolutionsarebuilt,however,thefuturestartstobecomemuchmoreattainable.TakeMangoMaterials.Therenewablebioproductsstartupcollaboratedwithresearchersaroundtheworldtoofexecutivesbelievesciencetechcapabilitiescouldhelpaddresssocietalgrandchallengesofhealth-relatedissuesanddiseases,while75%believesciencetechcapabilitiescouldalsohelpaddresspoverty/inequality.83%IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier15#TechVisionTechnologyVision2023WhenAtomsmeetBitsdevelopabacteria-producedbioplasticdesignedtodecomposeintheocean.30Sofar,fiveoceanographicequipmentmanufacturingpartnershavecommittedtoreplacingalltheirtraditionalplasticwiththisnewdegradablebioplasticonceit’sready,withcommercializationandotherproductapplicationsbeingexploredasthecollaborationevolves.31Orlookatthegrandchallengeofdeliveringbetterhealthcare.Whenitcomestousingdatatoimprovetreatment,hospitalsaretypicallylimitedtotheirowndatasetsforpatientprivacyreasons.ButinarecentstudypublishedinNatureMedicine,20hospitalsfromaroundtheworldparticipatedintrainingafederatedlearningmodelcalledEXAM,whichpredictedfutureoxygenrequirementsofCOVID-19patients.32Themodelleverageddata,includingpatientvitalsigns,laboratorydata,andchestX-rays,fromalloftheparticipatinghospitals—buteachhospitaltrainedtheirowncopyoftheAImodelandperiodicallysharedupdateswithacentralizedserver,whichthenaggregatedthemtotraintheglobalmodel.Inthiscase,thehospitalscreatedasharedrealitythattheycouldn’thavebefore,usingfederatedlearningtosafelysharedigitaldataonphysicalinformationtoimproveAIpredictions.16TechnologyVision2023WhenAtomsmeetBits#TechVisionFoundationsforanewrealityMountingchallengesontheglobalstageareforcingenterprisestoreorienttheirbusinessobjectivesandimaginehowtheycanbestcontributetosolvingthesecollectiveproblems.Someoftoday’sproblemsmighthavebeenconsideredunsolvablebefore—butastheconvergenceofatomsandbitscontinuestogrow,theboundsofpossibilityexpand.Digitalidentitygivesusafoundationtotraversedigitalandphysicalworlds;transparencybuildsthetrustandunlocksthedatainsightsnecessarytoexposeandtacklecollectiveproblems;generalizingAIprovidesuswiththemachinepowertoaidusindoingso;andourforeverfrontierisrapidlyexpandingaswebringphysicalsciencesandinformationtechnologyclosertogether.Thesefoundationsofournewrealityarethepathtotakingaction.Theworldiswatching.Whatwillyoudonext?IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontierIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier17#TechVisionTechnologyVision2023WhenAtomsmeetBitsDigitalidentityIDforeveryoneandeverythingDigitalidentityisquietlybecomingthekeytoenterprises’technologyaspirations,andeffortstoreimagineitareunderway—notjustforpeoplebutforallthings.Yourdata,mydata,ourdataWhytransparencywillbecomeyourmostpreciousresourceDataecosystemsarebeingreshapedbyradicaltransparencyasenterprisesleveragetheirtrovesofdatatoofferunprecedentedinsightintotheirbusiness.GeneralizingAITheradicaledges—andpossibilities—ofintelligenceFoundationmodelsaredrivingoneofthebiggeststepchangesinAIhistory.Now,enterpriseleaderscanshiftfrombuildingtheirownAItobuildingwithAI.OurforeverfrontierThebigbangofcomputingandscienceAfterdecadesofhyperfocusondigitaltechnology,scienceisleapingbacktothetopofenterprises’agendas.OurFourTechnologyTrendsfor2023#TechVisionTechnologyVision2023WhenAtomsmeetBits18CompletingthepictureAccenture’sTechnologyVisionreportcomprisesathree-yearsetoftechnologytrends,currentlyincludingtrendsfrom2021and2022.It’simportanttorecognizethateachyear’strendsarepartofabiggerpicture.Trackinghowtheyevolveovertimeoffersaglimpseintohowtheymaycontinuetogrowinthefuture.2022TrendsWebMeComputingtheImpossibleTheUnrealProgrammableWorldStackStrategicallyAnywhere,EverywhereI,TechnologistMirroredWorldFromMetoWe2021Trends2023TrendsDigitalidentityOurforeverfrontierGeneralizingAIYourdata,mydata,ourdataIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontierIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier19#TechVisionTechnologyVision2023WhenAtomsmeetBits2022TrendsWebMePuttingtheMeinMetaverseTheinternetisbeingreimaginedasmetaverseandWeb3effortstransformtheunderpinningandoperationofthevirtualworld.ProgrammableWorldOurPlanet,PersonalizedControl,customization,andautomationarebeingenmeshedintotheworldaroundus,makingthephysicalasprogrammableasthedigital.TheUnrealMakingSynthetic,AuthenticAsAI-generateddataandsyntheticcontentconvincinglymimicwhatis“real,”authenticityisthenewnorthstar.ComputingtheImpossibleNewMachines,NewPossibilitiesAnewgenerationofcomputersaresolvingsomeoftheworld’smostintractableproblems,leadingtooneofthebiggesttechnologicaldisruptionsofourtime.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier20#TechVisionTechnologyVision2023WhenAtomsmeetBitsStackStrategicallyArchitectingaBetterFutureAneweraofindustrycompetitionisdawning–onewherecompaniescompeteontheirarchitecture.MirroredWorldThePowerofMassive,Intelligent,DigitalTwinsGrowinginvestmentsindata,AI,anddigitaltwintechnologiesaregivingrisetoanewgenerationofbusinessandintelligence:themirroredworld.I,TechnologistTheDemocratizationofTechnologyNaturallanguageprocessing,low-codeplatforms,roboticprocessautomation,andmorearedemocratizingtechnology,puttingpowerfulcapabilitiesintothehandsofpeopleallacrossthebusiness.Anywhere,EverywhereBringYourOwnEnvironmentIt’stimeforenterprisestotransformremoteworkfromanaccommodation,toanadvantage.2021TrendsFromMetoWeAMultipartySystem’sPathThroughChaosTheglobaldisruptionofCOVID-19ignitedascrambleforenterprisestoreimaginetheirpartnerships–andmultipartysystemsgainednewfoundattention.21#TechVisionTechnologyVision2023WhenAtomsmeetBits21#TechVisionTechnologyVision2023WhenAtomsmeetBitsIt’s2035,andoldcollegefriendsMiriam,Alex,andBenaregrabbingaquickcoffeebeforework.Ben’sfavoritecoffeechainhasjustopenedanewcaféinhisofficebuilding,soheandMiriammeetthere.“Alextexted—somethinghecticisgoingonatthefarm,butshesaysshe’sreadywhenweare.”Bensaysashegetsinlinetoorder.“Ihopeeverything’sokay,”saysMiriam,“Iactuallyorderedahead—I’llgopickupmydrinkandgrabatable.”WhenBengetstothefrontoftheline,hegreetsthebaristaandtoucheshisthumbtothefingerprintsensoronthecounter.“Oh!Tryingoutthepersonalizationprogramtoday?”saysthebarista.“Yeah!I’vebeenhearingaboutit—I’mexcitedtoseewhatthefussisabout,”Bensays.Thescreeninfrontofhimspringstolifewithdozensofhispreferences—idealcaffeinationlevel,flavoraffinities,milkcontent,exacttemperature,andmore.“YougotallthisfrommetalkingtoanAIforAdayinournewrealityfiveminutes?”heasks,eyeswidening.“Wild,right?”saysthebarista.“Theseareyourdefaultpreferences,butyoucantweakthemintheapp,andeachtimeyoucheckoutit’llconfirmwhatyouwantjusttobesure.Hit‘OK’whenyou’reready—lookslikewe’realreadyconnectedtoyourwalletforpayment.”Ben’sfeelingabittired,soheraiseshiscaffeinelevel,thentapsthe‘OK’button.“That’sit?”heasks.“That’sit,”saysthebarista.“Ourbeandispenserwillgiveusacustomblendofour18coffeevarieties—tailoredjustforyou.ThenI’llmakeyourdrinkandhaveitoutinafewminutes.”AsBenturnstofindMiriam,hiswatchvibrateswithanotification,lettinghimknowhe’sbeenairdroppedanNFTfortryingthepersonalizationprogram.Miriamissittingatatableforthree.“We’rejustaboutready,”shesaysashesitsdown.TheyputontheirARglasses—andfinallytheycanseeAlex,sittingintheemptyseatbesidethem.OurTechnologyVision2023trendsaredrivinganewreality—onewhereourphysicalanddigitalworldsconverge.Asweprogressthroughthereport,wewillcontinueBen,Miriam,andAlex’sstoriestoillustratewhatthisrealitycouldlooklike,andhowourtrendscouldimpactbusinessesandpeople’slives.InvisibleARlensespersonalisedbrewIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier22IDforeveryoneandeverythingTechnologyVision2023Digitalidentity22IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier#TechVisionTheRSAcompanyreleasesakeyfobthatdisplayscodestosupplementpasswords–thefirstexampleofmodernmultifactorauthentication331986JohnDaugmanofCambridgeUniversityreceivesapatentforthefirstirisidentificationalgorithm341994MicrosoftacquiresHotmail,anemailservicewith9millionusers351997Estoniaintroducesamandatorydigitalidentitysmartcard362002FacebookConnect,oneofthefirstsocialmedialoginservices,islaunched372008Chinaintroducesanationalpilotofitssocialcreditsystem382014ThecryptowalletMetaMaskislaunchedfortheEthereumblockchain392016TheEUpassesGDPR,settinganewstandardindataprotectionlaw422016India’sdigitalidentityprogram,Aadhaar,enrolls1billionresidentsandisestimatedtosavethegovernment$1billionanually40,412016DeltaAirlinesopensthefirstbiometricterminalintheU.S.,allowingtravelerstousefacialrecognitionforcheck-in,bagdropandmore432018ApplepartnerswithseveralU.S.statestointegratedriver’slicensesintoconsumers’AppleWallets442021Amajorairlinetokenizesitsloyaltyprogram,givingcustomerstheabilitytotrade,sell,andchoosehowtousetheirmiles2024AmajordeliverycompanyfacesaPRcrisiswhenbiometricpersonaldataisstolenbecauseofpoordatasecurity2025Tolimitprescriptionfraud,medicalinsurersandhealthnetworksagreetomakebiometricidentificationtheindustrynorm2026Amajorcarmanufacturerlaunchesadigitalleger,creatinguniquetokensforeachcar,allowingcustomers,dealers,andserviceproviderstologaccidents,maintenanceandsalesofspecificvehicles2028Aconsortiumofmajorbanksentirelydropsemailloginoversecurityconcerns203020%ofmetaverseusersalsousetheirmetaverseidentityforphysicalworldactivitieslikeofficebadgingorcarrental2031Severalcountriesbegintoacceptadigitalinternationaltravelidentificationsysteminplaceofphysicalpassports2033TimelineDigitalIdentity#TechVision23IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontierIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier24#TechVisionTechnologyVision2023WhenAtomsmeetBitsThebigpictureDigitalidentityisquietlycatalyzingthenextgenerationoftechnologydisruption,andtheworld’sleadinginnovatorsarestartingtoact.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier25#TechVisionTechnologyVision2023WhenAtomsmeetBitsInAugust2022,MicrosoftlaunchedMicrosoftEntraVerifiedID,anewproductbasedondecentralizedidentitystandards.Thecompany’svisionistobuildanewfuturefordigitalidentity,whereinsteadofwidelyspreadingidentitydataacrosscountlessappsandplatforms,peopleandorganizationscanhavegreatertrustinandcontroloverwhatinformationisaccessed,bywhom,andforhowlong.45,46Andalready,proofofconceptsandpilotprogramsareunderwaywithtwouniversities,ahealthcaresystem,andagovernmentservice.47Andothercompaniesarealsoinnovatinginthisspace.EarlyWarningServicesandsevenbanksincludingCapitalOne,WellsFargo,Chase,andBankofAmericalaunchedAuthentify—anidentityverificationproductthatletsuserslogintotheironlinebanksfromparticipatingwebsitesandapps,streamliningtheprocessforsharingsensitivebankingdata.48ApplehasexpandeditsWalletapp,movingbeyondpaymentinformationtoletusersstoreandsharegovernment-issuedIDslikedriver’slicenses.49Andwhilenotanexampleofinnovationitself,theBill&MelindaGatesFoundationcommitted$200milliontodigitalpublicinfrastructureprojects,includingdigitalID.50Theseareonlyafractionoftheinitiativesunderway,andthemarketfordigitalidentityisexpectedtoswellfrom$27.9billionin2022to$70.7billionby2027.51Digitalidentityiseverevolvingandnotoriouslychallenging,butwhattheseleadershaverecognizedisasimpletruth:Today’sidentityeffortswilldirectlyshapetomorrow’smostinnovativebusinesses.What’smore,theentireC-suiteneedstopayattention.WhiledigitalidentitygivestheillusionofbeingatechnicalchallengesuitedfortheCIO’sorCTO’spurview,thetruthisitunderpinsmanyofourgreatestbusinessambitions.Imaginewhatthenextdecadeofyourenterprisecouldlooklike.Doesitincludethemetaverse,wherepeopletraverseapersistentdigitalenvironmentforwork,socialization,andrecreation?Maybeitinvolvestheprogrammableworld,wherethephysicalenvironmentisthreadedwithtechnologysuchthatpeoplecancommandtheirsurroundingswithawordorgesture.Orperhapsitentailsthegrowingintersectionofscienceandtechnology,wherepossibilitieslikepersonalizedmedicinecanbeIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier26#TechVisionTechnologyVision2023WhenAtomsmeetBitsrealized.Whateveryourpreferredvisionis,thenextdecadeoftechnologydisruptionisbeingshapedbyhowourdigitalandphysicalworldsintersect—andtheveryepicenterofthatexchangeisdigitalidentity.Lookatwhatb.wellisdoingtoimprovehealthcareexperiences.52Formanypatients,thereiscriticaldatathatcouldimproveoutcomes;medicalrecords,familyhistory,genomicdata,financialinformation,evenwearablesthattracksleep,exercise,anddietcouldbeusedbyprovidersandpayerstodeliverbetter,morepersonalizedcare.Butthisdataexistsacrossamultitudeofplatformsandhosts,forcingpatientstorepeatedlyvalidatewhotheyare.Thiscanmeangoinginpersontoofficestorequestdata,providingphysicalIDtoprovewhotheyare,andthentakingdatatotherelevantpartyjusttogothroughIDverificationalloveragain.There’stoomuchfrictionthatfrequentlyleavesthiscriticalinformationuntapped.b.wellsawthisasanidentitychallenge,andpartneredwithMastercardtobuildanewintelligentidentityplatformforhealthcaresystems.Theirplatformreplacesemailsandpasswordswithofglobalexecutivesagreethatdigitalidentityisnolongerjusta“technicalissue”;it’sbecomingastrategicbusinessimperativefortheirorganizations.85%mobile-nativebiometricsandprovidessecuredocumentscanningandstorage,givingusersgreatercontrolovertheirmedicalinformationandlettingthemseamlesslyshareitwithprovidersandpayers.53Moreover,itopensthepossibilityofintegratingotherdata,likeproofofincome,toeasetheapprovalprocessforinsurancepoliciesorfinancialreliefprograms.Andonthehealthcareside,itgivesprovidersaccesstostandardizedandhigh-fidelityinformationaboutthoseintheircare,allwhilereducingfraudandrisk.54Althoughthisexampleiscontainedtoasingleecosystem,itsendsastrongmessage.Emergingdigitalidentitysolutionsareprecisely,ifunsuspectingly,theanswertocreatingthetypesofmulti-partnervaluepeopleandenterpriseshavelongbeendesperatefor.Everybusinessleaderneedstorecognizethatdigitalidentityisn’tatechnologyquestion—it’sastrategicbusinessimperative.Thewebwasneverbuiltwithanidentitylayer,andascompanieshaveincreasinglyreliedondigitaltechnologytoruntheirbusinesses,thechallengesresultingfromthatgaphaveIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier27#TechVisionTechnologyVision2023WhenAtomsmeetBitscontinuedtogrow.People,assets,servicesandthedatawehaveaccesstoareallpredicatedonstrongidentity(knowingexactlywhoorwhatsomethingis).Howbusinessesensureresilience,security,privacy,consentandtrustisinextricablydependentonthequalityofdigitalidentity—andthesearechallengesthatcontinuetoplagueenterprisestoday.Whilepatchworksolutionshavegottenustothispoint,achievinganyfurtherambitionswillrequiresolvingtheunderlyingproblem.Onlysecureandtrusteddigitalidentitywillletpeoplefrictionlesslyauthenticatethemselvesacrossanydigitalorphysicalenvironment,maintainfirmercontroloverthedatatheystoreandhowitisshared,andalleviateconcernsaroundsecurity,privacy,andhumanfactorslikepasswordfatigue.Andforenterprisesitcouldeliminatered-tapeandreduceriskbyhavingamoresecureecosystemforhumanandnon-humanentitiesalike.Butimportantly,earlyinnovatorsinthisspacearenowfindingthatdigitalidentityisn’tjustaboutshoringupoversightsofthepastbutalsofuture-proofingtheenterpriseforaworldwheredatasharingandownershipisdramaticallydifferent.Theconceptofatrusted,portabledigitalidentityacrossthewebdisruptsmanyoftheconventionswe’vecometoaccept.Tokenization,forinstance,isoneofthemostinnovativetechnologytrendsthatistransforminghowweauthenticateourselves,sharedata,owndigitalassets,andtrackphysicalthings,andit’sentirelypredicatedontheabilitytoreliablyidentifyanyperson—oranything—inatrustedandsecuremanner.Everybusinessleaderneedstorecognizethatdigitalidentityisn’tatechnologyquestion—it’sastrategicbusinessimperative.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier28#TechVisionTechnologyVision2023WhenAtomsmeetBitsLookathowWienEnergie,anAustrianenergyprovider,recentlytokenizedoneofthelargestphotovoltaic(PV)solarplantsinthecountry.55ThecompanycreateduniqueidentifyingtokensforeachindividualPVmoduleintheplant,whichwerethensoldtocustomers.Tokenholdersreceiveanannualpaymentrelativetotheamountofenergyproducedbytheplant.Rightnow,it’saclosedsystem,sopaymentismadeintheformofdiscountsonelectricbills.Butthecompanyenvisionsafuturewherethesetokenscanbeusedtofundnewplants,usedasproofoforiginforenergysources,ortradedtofuelthingslikeelectricvehicles.BygivingtheplantandsolarcellsauniquedigitalID,thecompanywasabletoexposeinnovativenewbusinessmodels,onesthatturnedcustomersintostakeholders.However,thetimetoseizetheopportunityandbecomeanearlyleaderisnow,anditwon’tlastlong.Gainingadvantagewithsinglesolutionsandone-offdisruptiveneweffortstodayisonlypartofthestory.Enterpriseleadersmustgraspthefullscaleandspeedatwhichidentityischangingourdigitalandphysicallandscapes.Whatwearetrulywitnessingisnothingshortofdigitaltransformationatasocietallevel.TheUNcallsforthecreationofalegalIDforallpeopleby2030aspartofitsSustainableDevelopmentGoals,soit’snosurprisegovernmentsaroundtheworldarebeginningtomakedigitalidentityatoppriority.56Asoneofthefirstdigitalidentityadopters,Estoniahas98%ofitscitizensregisteredwithitselectronicidentitysystem(e-ID)thatisusedforpublicserviceslikevoting,healthinsurance,taxes,andmore.57India’sAadhaar,witha93%adoptionrate,tiesbiometricinformationtoa12-digitpinandhasbeenusedforofflineandonlinepurposeslikeCOVID-19vaccinationsandcontacttracing,aswellasbankingandfinancialservices—anditisnowbeingadoptedbySriLankatoo.58,59,60,61,62AndtheEuropeanUnionplanstorolloutadigitalidentitysystemin2023.63Soonenough,itwon’tjustbeearlyadopterscreatingdigitalidentities.Businessesmaysoonberequiredtodosotointegratewithstate-levelprograms.Digitalidentitymaynotbeasignificantpartofyourinnovationagendatoday—butitneedstobe.Theimperativeistwo-fold:whilethereisopportunitytoexplore,findvalue,andinnovatearounddigitalidentityrightnow,thereisalsoaspeedingtorrentofchangecomingthatwillinevitablyshapewhatallbusinessescando,andhowtheydoit,acrosstheweb.Somewillexperimentwiththeirowndigitalidentityprojects.Otherswillinvestigateandprepareforhowchangestodigitalidentitywilldemandbusinesstransformation.Andforeveryone,regulationsaresuretocome,sothelastthingyouwantistobecaughtoffguardandleftbehind.It’stimetostopoverlookingdigitalidentity.Letitcatalyzeyourfuture.Digitalidentitymaynotbeasignificantpartofyourinnovationagendatoday—butitneedstobe.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier29#TechVisionTechnologyVision2023WhenAtomsmeetBitsThetechnologyTheemergenceofnewdigitalidentitysolutionsisbothopeningthedoortonewformsofvaluecreationandchallengingenterprisesofallsizesandindustriestorethinkhowidentityisusedacrosstheorganization.Graspingthesignificanceofthistrendiskeytorecognizingtheopportunitythatliesahead.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier30#TechVisionTechnologyVision2023WhenAtomsmeetBitsTostart,ithelpstoconsidertwobasiccategoriesofidentity:Thefirstiscoreidentity,ortheprimaryidentifierofwhoorwhatsomethingis.Thesearecreatedforgeneralpurpose,likeanationalIDorlegalnameloggedinaregistry.Thesecondcategoryisfunctionalidentity,whichiscreatedforaspecificpurposetoconveycertaincharacteristicsordataaboutaparticularthing—likethewayadriver’slicensenumberiscreatedtoconveysomeoneislegallyalloweddrive,orthewayinternetcookiesareusedtomanagesessionsandyouractivitywhentraversingtheweb.Ofcourse,internetcookiesand(insomecountries)driver’slicensesaren’tusedexclusivelyforthosededicatedpurposes.Inpractice,alltoooftenwetakefunctionalpiecesofinformationintendedforaspecificpurposeand,inlieuofabetteroption,usethemascoreidentity.Considerwhatishappeningtophonenumbers.Mobilephonenumbersareafunctionalpieceofcontactinformation.Yet,ourphonenumbershaveincreasinglybecomethegatewaytoourdigitallives,suchthattheyarebeingusedlikecoreidentifiers.Whenourbank,work,orsocialappswantustoprovewhoweare,whatdotheydo?Sendusatextmessage.We’vetakenanumberwesharepublicly,forthosewhowanttocommunicatewithus,andturneditintoproofofwhoweare—andnowwearestartingtoseetheconsequences.InonetypeofattackcalledSIM-swapping,hackersusesocialengineeringtacticstoconvincemobilecarrierstore-routeatarget’sphonetraffictoanewSIMcard.Atthatpoint,anymessages,calls,orverificationcodessenttothetargetnumberarereceivedbytheattackerinstead.In2021,theFBIlogged1,611oftheseattacks—thiswas5xgrowthoverthepreviousthreeyearscombinedandamountedtoanastounding$42,000inaveragedamagesperattack.64Atthispoint,ifahackerhasyourphonenumber,theymayaswellbeyou.Digitally,weseethishappenallthetimebecausetheinternetwasnotbuiltwithcoreidentityinmind.Theentireecosystemhasbecomeoverlyreliantonleveragingfunctionaldata,likeemailaddressesorsociallogins,toaccessservicesoridentifypeopleacrosstheweb.Butnowthelegacyofneverhavingbuiltasystemforcoredigitalidentityiscatchingupofglobalexecutivesagreeissueswithauthenticatingcustomers’identityarenegativelyimpactingtheirbottomline(e.g.,abandonedtransactions,customerfrustration,fraud).76%IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier31#TechVisionTechnologyVision2023WhenAtomsmeetBitswithus,openingthedoortofraudandfracturedexperiences.Arecentstudyshowedthatoverhalfofconsumershaveabandonedapurchaseorbookingonlinebecausetheyforgottheirpasswordandretrievingitwouldtaketoolong.65Invalidtraffic(thetrafficcomprisedofbotsandfakeusers)accountsfor40%ofallwebtraffic,whichisamajorissueforsecurityandmarketingteams.66Andadfraud,includingclickfraud(wheninvalidtrafficengagesanonlinead),iscostingbusinessesbetween$35-40billiondollarsannually,surpassinglossesfromglobalcreditcardfraud.67Asthesignificanceofourdigitalliveshasgrown,theproblemshaveonlybecomemoreacute.Forinstance,customersmayinadvertentlyusemultipleemailaddressesforasingleservice,andbarringanonerousreconciliationprocess,thismeansmultipleprofilesforthesamecustomerorvendormayexist,leadingtobillingissues,frustrationwithloyaltyprograms,problemsprocessingreturnsanddeliveries,andmore.Inessence,theabsenceofstrongcoredigitalidentityhasbecomeanartificiallimitonwhatwecandowithtechnology,aswellasadownsidetobusiness.Thisiswhydigitalidentityisattractingsuchsignificantinvestment.Atatimewhenwearereimaginingtherelationshipbetweenourdigitalandphysicallives,wewanttoavoidthemistakesofthepast.Leadinginnovatorsarecreatingthisbaselayerofidentitythathaslongbeenmissingandforgingsolutionsthatwillbecomenothingshortofournewon-ramptotheweb.Atatimewhenwearereimaginingtherelationshipbetweenourdigitalandphysicallives,wewanttoavoidthemistakesofthepast.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier32#TechVisionTechnologyVision2023WhenAtomsmeetBitsAlready,digitally-borncoreidentitiesarestartingtoemerge.Unsurprisingly,manyofthebiggesteffortsarespearheadedbygovernments,thoughthereareanumberofpublic-privatepartnershipsandgrassrootseffortsaswell.It’sacomplicatedlandscape,buteveryenterpriseneedstotakenoteoftheseevolutionsastheywillquicklybecomeaprimarywaytoengagecustomers.Thebestwaytomakesenseoftheseeffortsistolookatthemacrossaspectrumofcentralizedtodecentralized,eachwithadvantagesanddisadvantages.TheModularOpenSourceIdentityPlatform(MOSIP)isanexampleofacentralizedeffort.ItisbasedoffIndia’sAadhaarsystem,butiscompletelyopensourceandmodular,meanttofitvariouscountries’requirements.Governmentscanleveragethecodeasastartingpointtobuilddigitalidentitysystemswhichtheythenhavecompletecontrolover.MOSIPisintendedtohelpcountries—particularlyinregionswherephysicalinstitutionsareweak(orlackingentirely)—fasttrackintothedigitalerabyimplementingidentitycapabilitiesbuiltdigitallyfromthegroundup.ItiscurrentlybeingusedinEthiopiaandthePhilippines,andthereisaplannedinter-countryeffortacrossWestAfricatoo.68,69Centralizedeffortstendtobeeasiertodeployandtobuildforpurpose,andforthosereasonsmaycometodominatemuchofthecoreidentityecosystem.However,aswithanycentralizedsystem,challengesincludeconcernsoverasinglepointoffailureandprivacyfearsoverwhocontrolsthecentralizedplatform.Theother,increasinglypopular,approachtocoreidentityhasbeentocreatedecentralized,ordistributed,platforms.Theseefforts,sometimesknownasSelf-SovereignIdentity(SSI),arebasedonblockchainanddistributedledgertechnology,soratherthanonecentralauthority,theyrelyonconsensusmechanismsfrommultiplepartiestovalidateidentity.Inlate2022,theWorldWideWebConsortium(W3C)publishedaspecificationforofexecutivesreporttheirorganizations’preferredstrategyleanstowardcentralizedsolutions,and54%aspartnership-ledsolutions,toaddresschallengesfacedbythelackofstandardizeddigitalidentity.79%Coredigitalidentity:centralizedvs.decentralizedIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier33#TechVisionTechnologyVision2023WhenAtomsmeetBitsDecentralizedID(DID),signifyinganimportantstepforwardfordecentralizedidentityefforts.70Alsoinfall2022,theLinuxFoundationannouncedtheOpenWalletFoundation(OWF).Insteadofpublishingidentitycredentialsorstandards,OWFwantstocreateopen-sourcesoftwarethatwilldemocratizetheprocess,allowinganyorganizationtodeveloptheirowndigitalwallet.71Earlyeffortsarealreadydemonstratinghowdecentralizedcoreidentitiescouldradicallytransformourexperiencesontheweb.Forexample,Microsoft’sIONisanidentificationservicethatrunsontheBitcoinnetwork.UsersofIONcanreplaceemailandpasswordloginswithauniqueidentifierauthenticatedbyblockchain.72Anyotherpersonaldataexistsoff-chain,makingthispurelyacoreidentitysolution.AndWeb3wallets,likeMetaMaskandTrustWallet,areincreasinglybeingpositionedascoreIDsaswell.Theyprovideuserswithauniquenon-custodialID(theindividualholdstheprivatekeytotheID),whichcanbeusedtoaccessawholeslewofnext-generationdigitalservices,likestoringNFTs,transferringcryptocurrency,orinteractingwithdistributedapps(dApps).73Theadvantagestodistributedapproachesareenhancedsafety,security,andtrust—butthenatureofdecentralizationleavesthingshardertobuildforpurpose.Usability,interoperability,andfearsoveraccountrecoveryarechallengesthatcanenduphurtingadoption.Importantlythough,enterprisesdon’thavetowaitfortomorrow’sstandardsorappstostartbenefitingfromthistechnology.ThegovernmentofBritishColumbia(BC)builtOrgBookBC,ablockchain-basedpubliclysearchabledirectoryforthe1.4millionorganizationsregisteredintheprovince.74Countrywideeveryyear,CanadiancompanieswasteanestimatedC$10billiononadministrativeredtape,likevettingpermits.75Now,withOrgBook,auniquedigitalidentityiscreatedforeveryregisteredbusinessinBC,whichisthenassociatedwiththevariouslicensesandpermitsthebusinesshasqualifiedfor.ThisallowsOrgBookBC’spublic-facingwebsitetoautomaticallyvalidateacompany’sIDandcredentialsagainsttheblockchaineverytimeitsnameappearsinasearch,providingusersatrustedrecordofcompanies’registrationstatusandselectedlicensesandpermits.Asitstands,thecoreidentityecosystemismessy—atestamenttotherapidinnovationhappeningtoday.Buttheamountofchangebubblingbeneaththesurfaceisenoughthateveryenterpriseshouldtakenote.Fromlargestate-ledprojectstonovelmethodsofauthentication,howenterprisesengagepeople—whethercustomeroremployee—isstartingtochangeonafoundationallevel.What’smore,whilethatalonewouldbeenoughtore-engineersystems,anevenbiggerchangeisyettocome:howtheuseofthoseidentitiesisstartingtoevolve.Earlyeffortsarealreadydemonstratinghowdecentralizedcoreidentitiescouldradicallytransformourexperiencesontheweb.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier34#TechVisionTechnologyVision2023WhenAtomsmeetBitsTheimplicationsParalleltothewellspringofefforttointroducecoredigitalidentityisanequallylargepushtorethinkthefunctionofthoseidentities:howwecreateandassociatedataaboutthoseidentities,howthatdataissharedandmanaged,andthebalanceofownershipacrosstheecosystem.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier35#TechVisionTechnologyVision2023WhenAtomsmeetBitsEachneweffortforcoredigitalidentityislikeastonecastintowater,andtheunderlyingchangestothedataecosystemaretherippling,lingeringresults—andthisiswheretherealopportunitybegins.Todaythesechangesarejuststartingtomanifest,soleadershaveachancetopullahead,leadtheircompetitors,andshapewhatcomesnext.Butnewformsofdigitalidentityandthesubsequentdataparadigmsaregrowinginpopularitybytheday,soleftunaddressed,businessesleaderswillquicklyfindthemselvesracingtocatchuptoafuturetheyareunpreparedandill-equippedtoengagewith.Already,someareexperimentingwithhowdigitalidentitiesallowthemtoapproachdatadifferently,devisingandexecutingnewstrategiesthatleanintothenovelcapabilitiesthetechnologypresents.TakeStarbucks,whichisexploringhowdigitalwalletscantransformtheirloyaltyprogramwithanewNFTeffortcalledStarbucksOdyssey.BasedWhileStarbucksismoreofacontainedecosystemfornow,Permission.ioislookingtointroduceasimilarparadigmacrosstheweb.Permission.ioallowsadvertiserstoallocateadedicatedamountofthecompany’scryptocurrency($ASK)toagivenadcampaign.78Consumerscanthenearnvaryingamountsofthecurrencybyoptingintodatasharingorengagingwithcontent.Consumershavethefreedomtodowhattheywantwiththeirearnedcurrency—eitherholdit,sellitonanopenexchange,orbeimmediatelyrewardedbytradingitinonPermission.io’swebsiteforgiftcardstomajorbrandslikeDomino’sPizzaandNordstrom.79WhereasStarbucksallowsconsumerstoownashareintheirloyalty,Permission.iogivesconsumersanewabilitytoowntheirdataandattention.onaproof-of-stakeblockchainbuiltbyPolygon,Starbuckscustomerswillbeabletocollectuniquetokens,storethemindigitalwallets,andexchangethemforbenefitslikevirtualclasses,uniquemerchandise,oratriptooneofthecompany’scoffeefarms.76Thecustomerownstheirtokensoutright,soiftheydon’twantoneofthebenefits,theyarefreetosellitonOdyssey’sopenmarketplacetoanothercustomer.Ittransformsthestandardloyaltyprogramintoacommunityinwhichthecustomerisalsoastakeholderandhasmuchmorecontroloverwhattheyown.Starbucksknowsitspilotisexperimentalbutbelievesit’sanimportantfirststepto“[potentially]createanexpanded,shared-ownershipmodelforloyalty”—andtobuilduponinfuturecollaborationsaswell.77IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier36#TechVisionTechnologyVision2023WhenAtomsmeetBitsPermission.ioandStarbucksareleveragingtokenization,oneoftheleadingwaysenterprisesarestartingtoinnovatearoundidentity.Tokenizationistheprocessoftakinga“thing”andcreatinganassociateddigitalasset,oftenstoredonablockchain.Importantly,theseexamplesalsoshowhowidentityinnovationisn’tlimitedtopeople.StarbucksandPermission.ioaretokenizingloyaltyandattention.The“thing”canbeanyassetfromashippingcontainertoapieceofartorfinancialsecurities.Inessence,tokenizationistheprocessofcreatinganimmutable,functionalidentityforanything:physical,digital,unique,ornot.Andoncethoseidentitiesarecreated,enterprisescanstarttotransformwhattheydowiththem.UnileverandSAPareusingablockchainsystemwheretokensarecreatedatthesourceforbatchesofpalmoil.80ThetokensallowUnilevertotracespecificcropsthroughtheirsupplychainandconnectthemdirectlybacktothefarmstheyweresourcedfrom.TheIndustrialandCommercialBankofChina(ICBC)createdIcago,atokenizationsystemthatallowspublictransitoperatorstoissueNFT“carboncredits”toriders,whocanthenexchangethosetokensforChina’scentralbankdigitalcurrency.81AndGoldmanSachsisbuildinganend-to-endtokenizationsolutionforassetsinitsportfolio.82What’sclearisthatthedisruptiveimpactofthesechangestodigitalidentityisgoingtobehuge:itisbringingforwardanewparadigmfordataandownership.Andsoonenough,itwon’tjustbeleaderscapitalizingonearlyopportunitiesandupsides—everybusinesswillbeforcedtothinkaboutidentityanddatadifferently.Tokenizationistheprocessoftakinga“thing”andcreatinganassociateddigitalasset,oftenstoredonablockchain.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier37#TechVisionTechnologyVision2023WhenAtomsmeetBitsInearly2021,AppleintroducedanumberofprivacychangestoiOSthatturnedallthird-partyapptrackinganddatasharingintoanopt-inexperience;by2022,onaverageonly25%ofusersopted-intoapptracking.83,84AndGoogleintendstokillcookietrackinginitsChromebrowser.85It’snewplannedsystem,calledTopics,willcategorizeactivityinto350predeterminedgeneral“topics.”86Everyweekusers’topfive“topics”plusanadditionalrandomizedsixthtopicwillbecalculatedandstoredbyChrome—andonlyarandomsubsetwillbesharedwiththirdparties.87Afterthreeweeksthetopicsrefresh,andnohistoryofpasttopicsissavedorstored.Andifthereisskepticismaroundhowmuchenterpriseswilldrivethistrendforward,regulatorsaren’tfarbehindthem.Gartnerpredictsthatby2024,75%oftheglobalpopulationwillhaveitspersonaldatacoveredunderprivacyregulations.88Statedbluntly,bynochoiceoftheirown,enterprisesmaynolongerhaveaccesstothedatathey’reusedtohaving.Thethirdpartyandconsumerdatatheycurrentlyrelyonisstartingtodisappear,andwithnopreparationtorotatetothenewmodels,thetrickledowneffectcouldbemassive.Itiscrucialthatenterpriseleadersunderstandtheinflectionpointdigitalidentityisinrightnow:itisnotjustthatnewdoorsofopportunityarebeingopened,butmanyoftheoldonesthatenterprisesrelyanddependonarestartingtoclose.Whilethesechangesareoftenwelcomedbyconsumers,enterprisesareunderstandablynervous.69%ofU.S.marketersbelievetheeliminationofthird-partytrackingwillhaveagreaterimpactthanGDPR.89AndGDPRleftbusinessesscramblingtocomply.WhiledatacollectionandusewaslargelyaCIOactivitybefore,GDPRrequirementsforexplaininghowdatawasused,usercontrolrequirements,anddownstreamdatasharingquicklyropedeverypartofthebusinessintothediscussion.90Failuretocomplyhasbeenmetwithsteepfines—andnotjusttotechcompanies,buttohotelchainsandairlinesaswell.91Inshort,GDPRchangedtheriskproposition,guardrails,andrequirementsforhowenterprisesaroundtheworldusedata—andsubsequently,howtheyinnovate.WithdigitalidentitypoisedtobeadeeperandmoreseismicshiftthanGDPR,enterprisesneedtostartpreparingwiththesameurgency.Thisiswhyexperimentingwithnewformsofidentity,digitalwallets,andtokenizationisn’tallaboutchasingupside—it’saboutexploringandpreparingforthepivottomorrowwillrequire.Onyx,anidentitysolutionbeingdevelopedbyJPMorgan,forinstance,couldbeusedasawaytocredentialpeopleacrossthemetaverse,Web3,anddecentralizedfinance.92ThesolutionwillallowpeopletobinddigitalassetstoadecentralizedIDandthenpickandchoosewhichdatatheywanttosharetoaccessservicesacrossItiscrucialthatenterpriseleadersunderstandtheinflectionpointdigitalidentityisinrightnow.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier38#TechVisionTechnologyVision2023WhenAtomsmeetBitstheweb—suchasoptingtouseone’screditscoretoleveragea“buynow,paylater”option.93Whilethesolutionisstillindevelopment,theunderlyingtakeawayisthatoneofthelargestinvestmentbanksintheworld,accustomedtohavingdeepaccesstocustomerdata,isenvisioning(andbuilding!)aworldwherecustomersdecidewhatdatabusinesseshaveaccesstoandwhen.Asweshifttowardsaconsent-andvalue-baseddataecosystem,ratherthanthetrackandsurveilonethatexiststoday,businessesneedtobepreparedfordisruptionstotheirdatapipeline.Exploringtomorrow’ssolutionswillhelpenterprisesnavigatethosedisruptions,butthetechnologyaloneisonlyhalfthesolution.Enterpriseleadersneedtobeaskingthemselves:Howwillwegain—andearntherighttomaintain—accesstoaperson’sdata,whentheyaretheoneswhoownit?WithdigitalidentitypoisedtobeadeeperandmoreseismicshiftthanGDPR,enterprisesneedtostartpreparingwiththesameurgency.39#TechVisionTechnologyVision2023WhenAtomsmeetBits39ThebottomlineCoreidentities,biometrics,tokenization,andotheremergenttechnologiesarebeginningtoalleviatedigitalidentity’spastshortcomings—butwillalsochallengebusinessesinwaystheyareunpreparedfor,likeshiftingaccesstocriticaldataandneedingtointegratenewtechnologies.Buttheenterprisesthatrisetothechallengeandshapethefutureofdigitalidentitywillenjoyenhancedsecurityandresiliencetochangesinthewidermarketplaceandbuildrenewedconfidencewiththeircustomersandpartners.Mostimportantly,theywillhaveaheadstartonthefuture—andpushuseverclosertoabetterweb,andabetterworld.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier40#TechVisionTechnologyVision2023WhenAtomsmeetBits#TechVisionAftercoffeewithAlexandBen,Miriamdecidestowalktowork.Hercompany’sofficeisonly20minutesaway,butbeforelongshe’slightheaded,shortofbreath,andfeelsasharppaininherchest.Panicking,shecallsanambulance.Miriam’scallautomaticallytriggersanapponherphone,whichgrantsemergencyservicesaccesstohermedicalrecords.Whenparamedicsarriveafewminuteslater,they’vealreadycheckedherallergyandmedicalhistory,andgiveherashottoeaseherbreathing.Onceittakeseffect,theparamedicinchargeupdateshermedicationhistoryandsignswithathumbprint.Then,theiraccesstoherrecordsends.Later,Miriam’sdoctorwantstodigdeeperintotheissue,soMiriamusesherappagaintograntthedoctoraccesstoherrecords—specificallyhealthAdayinournewreality:Miriamandfitnesswearablesdata.Usingthisinformation,aswellascity-wideairqualitydata,thedoctorseesthatspikesinMiriam’sheartrateandbloodpressurearecorrelatedwithupticksinpollution.She’sdiagnosedwithsevereenvironmentalasthmaandrecommendedforanexperimentaldrugtrial.Aspartofthetrial,she’llrecordthefrequencyofherasthmaattacksandheradherencetothedrugregimeninherapp.Theinformationwillbeanonymized,andthenuploadedtoapublicdatabaseforresearchersanddoctorstoanalyze.Somedaywhenthestudyconcludesandhertestgroupisrevealed,theappwillautomaticallyupdatesohermedicalhistoryisalwayscomplete.TechnologyVision2023WhenAtomsmeetBits40IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontierIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier41#TechVisionTechnologyVision2023WhenAtomsmeetBitsWhytransparencywillbecomeyourmostpreciousresourceYourdata,mydata,ourdataTechnologyVision202341IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontierIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier42#TechVisionJapaneseclockcompanyYamasacreatesthefirstcommerciallyavailablepedometer(Manpo-kei)941965KelleyBlueBookpublishesthefirstNewCarPriceManual951966NASAlaunchesthefirstsatelliteoftheLandsatProgram,anefforttodocumenttheentireEarthfromspace961972Yelprevampsitswebsiteandallowsuserstostartsharingreviewsofbusiness972005Anestimated161exabytesofdataarecreatedthisyear982006Glassdoorlaunchesitspublicbetaversion,offeringtransparencyintosalarydataandemployeesentiment992008Anestimated2zettabytesofdataarecreatedthisyear1002010ZhamakDehghaniintroducestheideaofaDataMesh,anewenterprisedataarchitecture1022019TheU.S.CongresspassestheOPENGovernmentDataActrequiringfederalagenciestopublishtheirdataandmetadatainanopen,standardizedandmachine-readableformat1012018Anestimated64.2zettabytesofdataarecreatedthisyear1042020680financialinstitutionssendletterstotheboardsof10,400companies,askingthemtodiscloseenvironmentalimpactdata1062022Snowflake,aclouddatawarehousingcompany,goespublic,raising$3.4BinthelargestsoftwareIPOever1032020NasdaqbeginsrequiringcompanieslistedonitsU.S.exchangetopublishthediversitymetricsoftheirboards1072022Theamountofdatacreatedthisyearincreases150xover2022numbers2027Californiarequiresnewcommercialbuildingstoputtemperaturesensorsineachroomandreportaggregatedata2025AcitizenhackinggrouppublishesthesalaryandDEIinformationofmostFortune500companies2026Atelecomcompanydemonstratestheabilitytowirelesslytransmit1terabyteofdatapersecond2028TheEuropeanSpaceAgency(ESA)unveilsnewtechnologythattracksallorbitalobjectsanddeterminesownership.ESAplanstofineownersofobjectsthatviolatedeorbitinglaws2030Anationalgrocerychainisabletofacilitate1-dayrecallsforproducethankstotheirsupply-chain-widetraceabilityprogram2031Theamountofdatacreatedthisyearincreases300xover2027numbers2032Anewrecordissetforthemostsuccessfulorbitallaunchesinayear–1351052021TimelineYourdata,mydata,ourdata#TechVision42IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontierIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier43#TechVisionTechnologyVision2023WhenAtomsmeetBitsThebigpictureInthenot-so-distantpastwhenyouweredecidingwheretoeat,youmightrelyonword-of-mouthortheoccasionalexpertguide.Thenin2005,Yelpchangedeverything.108WorkinprogressIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier44#TechVisionTechnologyVision2023WhenAtomsmeetBitsThecompanycreatedadigitalserviceforcustomerstosharereviewsofbusinesses—whichisnowago-towebsiteforfoodies,basedonmillionsofrestaurantratingsandreviewsfromfellowdiners.Itwasanindustry-alteringmove.Yelpchangedhowpeoplefindrestaurants,howrestaurateursgetpublicity,andhowcustomersvoicetheirexperiencesatrestaurantsandotherbusinessestoo.Researchshowsthatarestaurantcanincreaseitsrevenueby5%to9%ifitsYelpratinggoesupbyonestar—andevenahalf-starbumpcanhelparestaurantsellout49%morefrequently.109,110Andit’sallbasedondatathatwasalreadyoutthere—customersalwayshadopinions,theyjustweren’trecordedormadeaccessibletothisdegreebefore.WhatYelpdidiscreatea“windowoftransparency”—aclear,detailed,andexpansiveviewintoapieceoftheworldaroundus.Beyondpuredata,thesewindowscanproviderealinsightsintobusinessprocesses,consumers,marketshifts,investments,corporateleaders,andentireindustries.Andtoday,they’reshakingupmorethanjustdinnerplans.Asbusinessesandgovernmentsaroundtheworldcontinuetoinvestindigitaltransformation,thesewindowsarepoppingupeverywhere.Lookattheairlineindustry.Foryears,industry-widedataonflyingwasscattered.ButCirium,anaviation-datamarketplace,figuredtransparencycouldimprovethewaytheindustryisrun.Thecompanynowquantifiesandaggregatesaviationdatafrom97%ofscheduledflightsworldwide,socustomerscantrackanaircraft’susageandpartwear,seereal-timeflightschedulesofabout880airlines,andevenfindaspecificflight’sCO2emissions.111,112,113Similarly,duetocountlessshippers,forwardingagents,andtransportationcompaniesbehindthescenes,thefreightindustryhaslongstruggledwithblack-boxcostsandpricevolatility.ButthecompanyXenetatackledthisproblembyaggregatingmillionsofdatapointsonoceanandairfreightratesaswellasshippinglanes.Xenetatodayanalyzesmorethan300millionfreightrates,160,000port-to-portlanes,and40,000airport-to-airportconnections.114Itusesthatdatatodefinebenchmarkratesatmarketvalueandsharesthoseratesonitsplatform.Overchargingiseasiertospotandstopasaresult.AssociatedIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier45#TechVisionTechnologyVision2023WhenAtomsmeetBitsBritishFoods,forexample,usedXeneta’sbenchmarkratestonegotiatea30%decreaseintheirshippingspending.115Withaclearwindowintotheindustry—onethatanyonecanseethrough—stakeholderscanleveragethisinformationtomaketheiroperationsmoreefficient.Sowhyisthisleveloftransparencyonlycomingtofreight,aviation,andotherindustriesnow,whenYelphasbeenfunctioningformanyyears?Itcomesdowntomaturingdigitalstrategiesandhowthey’vechangedthewaypeopleandenterprisesthinkaboutdata.Asbusinessesbuiltrobustdatapractices,theydrovemajorshiftsinthedataecosystem,fromtheskyrocketingvolumeofdatatotransformationsinhowdatacanbesharedandmanaged.Subsequently,enterprisestodayhavemorepreciseinsightintotheiroperationsthaneverbefore.Butthat’snotall.Astheappetitefordatagrows,it’salsochanging.Now,it’snotjustbusinesseslookingforthislevelofinformation,it’severyone:governments,consumers,employees,shareholders,watchdoggroups,businesspartners,media,evencuriousindividuals.ofglobalexecutivesagreedatatransparencyisbecomingacompetitivedifferentiatorfortheirorganizations.90%Insuccessfullycreatinggreaterlinesofsightintotheirbusiness,companieshavecreatedanewexpectation:Peoplebelievethatthisdataexists(orshouldexist),andtheywanttoseeittoo.Frominformationaboutsourcingtoclimateimpact,salaries,diversityhiring,andmore,wehaveshiftedfromaninformationenvironmentthatacceptsopacitytoonethatexpectstransparency.Forexample,whenitcomestomakinggrocerychoices,onereportfoundtwo-thirdsofshopperswouldswitchfromtheirusualbrandtoonethatprovidesdeeperinformationaboutproducts.116Anotherstudyfoundthat60%ofpeopleshoppingforclotheswantmoreinformationabouthowtheirclothesareproducedsotheycanmakemoreethicalpurchasingdecisions.117Andthistrendisn’trestrictedtoconsumers—thedemandisbeingdrivenbyallmannerofstakeholdersinanenterprise’secosystem.Theyarenolongerwonderingifenterpriseshavethedatatheywant,it’sanassumptionthattheydo.We’removingfromthehistoricrealitywheredatawasscarce(andoftenaproprietarysecret)toanewrealitywheredataisbeingsystematicallyquantifiedIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier46#TechVisionTechnologyVision2023WhenAtomsmeetBitsandmadeavailable—anditputsenterprisesinanumberofdifficultpositions.First,mostcorporatedataarchitecturesaren’tbuilttohandlethisleveloftransparency.Evenasmanyhavebuiltoutdatastrategies,theyarestillnotfullytappingintothedataattheirfingertips.Considerthis:theworldisbeingquantifiedatahistoricandacceleratingrate.47zettabytesofdatawerecreatedin2020alone—andby2035,itispredictedthat2,142zettabytesofdatawillbecreatedeachyear.118,119AndthenumberofconnectedIoTdevicesworldwideisexpectedtoreach27billionby2025.120Beforecompaniescaneventhinkaboutturningtransparencyintoaresource,theyneedtobepreparedtohandlethisquantityofdataandmanageitresponsibly.Second,evenifyourdataarchitectureisleadingedge,yourstrategiesinaworldofplentifuldataneedtochangetoo.It’snotenoughjusttohavethedata,yourcompanyneedstobeabletoassessthequalityandintegrityofit,aswellasactonandsharetheinsightsitfinds.Liketheaviationandfreightexamplesdemonstrated,transparencycanbringenterprisesbigadvantages.ItcanofferindustriesBeforecompaniescaneventhinkaboutturningtransparencyintoaresource,theyneedtobepreparedtohandlethisquantityofdataandmanageitresponsibly.growth,optimization,andefficiency.Itcanalsobolsteranenterprise’soperations,improvecustomerexperiences,andbuildatrustedreputationbydrivingaccountabilitytovalueslikefairnessandsustainability.TheSwedishfootwearbrandIcebugillustrateshowgivingcustomersmoreinformationcandriveloyaltyandprofits.Customerconsciousnesshasbeenamajorfactorinpurchasingdecisions—infact,66%ofcustomerswanteco-friendlyproducts.121Icebugrecognizedthatfootwearmakesup2%ofglobalcarbonemissions,sotheybetthatpublishingsustainabilityinformationwouldmakecustomershappier,ultimatelyboostingsales.122ThebrandpartneredwithfashiontraceabilityfirmTrusTracetocollect,store,andanalyzesustainabilitymetrics,suchasthepercentageofrecycledmaterialusedinashoe.Icebugmadethosefigurespubliconthebrand’swebsiteandinretailshops,andayearlater,sawa37.8%increaseinitsannualnetprofit.123IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier47#TechVisionTechnologyVision2023WhenAtomsmeetBitsSpotifydemonstratesanotherwaytoattractcustomersthroughinformationsharing.Firstintroducedin2016,SpotifyWrappedisapersonalizedsummaryofthemusic,artists,podcasts,andgenresthatauserlistenedtointhepastyear.124Bypackagingandpresentingpersonalizeddatafromanindividualuserbacktothem,itnotonlyallowsuserstoreflectontheyearandlearnabouttheirlisteninghabits,butitisalsodesignedtobesharedonsocialmedia,sparkingengagementandsurfacingcontent—withSpotifyatthecenter.In2021,SpotifyWrappedreceivedmentionsin1.2millionTwitterposts,andduringtheweekofitscampaign,downloadsofSpotify’smobileappincreased21%.Lastly,you’llneedtoupdateyourbrandingstrategy,becauseoncethiskindofdataexistsyoucan’tassumethatitwon’tgetouttothepublic.Skeptical?Mostcompaniesdon’tpublishsalaryinformation,butyoucanfinditonGlassdoor.WanttoknowwhothebiggestCO2emittersare?CheckouttheUniversityofMassachusetts’sGreenhouse100PollutersIndex.Increasingly,whencompaniesdonottakethehelm,gatheringandsharinginformationwithinaswellasbeyondtheirwalls,thirdpartiescanandwillmeetthatdemandfirst.Thisisageneration-definingmoment.Wearebeginningabusinesseradrivenbytransparencyratherthanopacity.Enterprisesareattheforefrontofchangesradicallyreshapingtheworld,andbeingaleaderinthisnexterawilldependontrust—makingtransparencyyourmostpreciousresource.Yettosucceed,yourcompany’sdatastrategy—howyoucreateandcollect,manage,anduseyourdata—likelyneedsareboot.You’llneedtolookatyourentiredatalifecycle,rethinkingwhatdatayoucollectandhowyoucollectit,lookingatyourdatamanagementapproachandhowitmightfallshort,andreassessinghowyouusedata,whohasaccesstoit,andwhatbusinessfunctionsyouwantfromit.It’sabigundertaking,butthebenefitsthatcanbegainedaretoobigtopassup.Wearebeginningabusinesseradrivenbytransparency,ratherthanopacity.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier48#TechVisionTechnologyVision2023WhenAtomsmeetBitsThetechnologyTheexpectationsaroundtransparencytodayareadirectfunctionofthetechnologythathasbecomeaninextricablepartofourworld.Toturntransparencyintoastrategicadvantage,enterpriseleadersfirstneedtounderstandthetechnologyshapingit,andwhytheconditionsdemandingtransparencywillonlyacceleratemovingforward.Then,theyneedtodesignthedatastrategiesthatwillletthemgenerate,manage,andsharetheirowndatawithease.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier49#TechVisionTechnologyVision2023WhenAtomsmeetBitsBackin2013,Targetmadewhatwas,atthetime,consideredanincrediblyboldmove.Thecompanybecameoneofthefirstretailerstoannounceayear-roundpricematchingpolicythatincludedpricingfoundonpopulare-commercesites.125Targetadoptedthispolicybecausetheyweregrapplingwitha“windowoftransparency.”Customerswerecomingintothecompany’sstores,tryingoutandfallinginlovewithaproduct,onlytopulluptheirsmartphoneandfindanonlineretailerwithacheaperprice.Shoppershadnearlyperfectinformation,instantlyattainableattheirfingertips,andsotheyactedonit.Whilepricematchingintheretailindustryisoldnews,whatitteachesusismorerelevanttodaythanever:theconditionsfortransparencyallcomedowntodataandconnectivity.InTarget’scase,whatdrovethemtoactwasacombinationofpricinginformationfromonlinecompetitors(anewdatasource)andfrictionlessaccesstothatdataviatheirsmartphones(connectivity).Today,weareseeingarapidaccelerationofbothnewtypesofdataandourabilitytotransmitandaccessthemwithunprecedentedspeed.Thisconfluenceiscreatingincredibleopportunityfor“windowsoftransparency”toopen,givingenterprisesastarkchoice:getaheadnoworriskmissingout.Worldwide,thesupplyofdataisgrowingfast.Muchofitisbeinggeneratedonline—inthepastyeartheinternethad5.07billionuserstotal,withanaverageof6.5hoursspentonlineaday.126However,thecontributorthatisperhapsmostinfluentialontransparencyishowadvancesinsensingtechnologyaregeneratingnewtypes,andenhancedfidelity,ofdataaboutourphysicalworld.Fromourhealthtoourhome,sensingtechnologiesincreasinglyplayanintegralroleinourdailylives.ThenewAppleWatchcancalculatesleepcyclesdowntotheminuteandtrackheartbeatirregularities.127AndinSweden,researchersbuiltalow-costnano-sensorthatcandetectpesticidesonfruitinamatterofminutes.128Whileeachofthesenewsensorsoperatesonasmallscale,theygiveclear,quantifiablelinesofsightintoincreasinglylargersystems.Oneresearcheffortdemonstratedhowalow-costmicrosensorcanrecognizeandlocatethedistinctsoundofaleakywaterpipewith100%accuracy.129ScientistsattheButdataaloneisn’tenough.Theavailabilityofthatdataiskey.That’swherecommunicationstechnologiescomeintoplay.BuildingtheconditionsfortransparencyIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier50#TechVisionTechnologyVision2023WhenAtomsmeetBitsUniversityofWashingtoncreatedaself-poweringsensorthatcanfloatintheairlikeadandelionseedandmeasurethetemperature,humidity,andotherdetailsofthesurroundingenvironment.130AndClimateTraceuses300satellitesandover11,100sensorstotrackcarbonemissionsacrossglobalindustrialsectorsorevenatasinglepowerplant.131Asthecostofsensorsdropsandtheircapabilitiesgrow,weareenteringatimewithextremelypreciseandexpansiveinformationaboutourbodies,environments,andworld.Whenenterprisesthinkaboutgeneratingandpullingbackthecurtainonthisdata,itcanbeusedtodisruptiveeffect.TakePlanetLabs.Everyday,satellitesfromPlanetLabscapture300millionsquarekilometersofimagesfromspaceata3.7-meterresolution—aclaritysohighthatthenakedeyecanseeindividualanimals.132,133ThecompanypartneredwithKingAbdullahUniversityinSaudiArabiatocapturedaily,cloud-freeimagesfromspaceofaNebraskacornfield.Theimagesshowedthecrops’health,whichhelpedfarmstailorfieldirrigation,andbetterpredictcropyields.134,135Butdataaloneisn’tenough.Theavailabilityofthatdataiskey.That’swherecommunicationstechnologiescomeintoplay.Inadditiontodatavolumesgrowing,weareseeingtheabilitytotransmitdatagrowdramatically—overlongdistances,toplacespreviouslyunconnected,andinnearlyreal-time.Forexample,T-Mobilehasbeenbuildingouta5Gnetworkandtheyarethinkingbiggerthanconnectivityjustforphones.ThecompanypartneredwithPanoAIandPortlandGeneralElectrictodeploy5G-connectedcamerasinremote,wildfirevulnerableareas.PanoAIplaceditsartificialintelligenceenabledcamerasinrurallocations,thenusedT-Mobile’s5Gnetworktoquicklytransmitthedata.136Thisletsusersaccessreal-timeobservationsanddata—andhasresultedinusersreportingfireswhentheystartandenablingauthoritiestorespondmorequickly.Andnow,T-MobileandSpaceXhavealsoannouncedapartnershiptouseStarlink’ssatelliteconstellationwiththegoalofprovidingnearcompletecoverageintheU.S.—eveninremotelocationspreviouslyunreachablebytraditionalcellsignals.137IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier51#TechVisionTechnologyVision2023WhenAtomsmeetBitsManagingthedatadelugeDataandconnectivitygeneratetheconditionsfortransparency—buttheydon’tguaranteeenterprises’abilitytomanageit.InaJune2022study,“EvolveYourDataPracticesToStayAheadOfTheCompetition,”Forresterfoundthat79%ofenterprisedecision-makersbelievedtheirenterprisestrugglesto“takeinsight-drivenactioninrealtime.”138Anunderlyingissueisthatdatawithinenterprisesisoftensiloed—soit’snosurprisethatwhenrespondentswereaskedtonamethetopchallengeinbetterusingcustomerdata,56%statedthelackofintegrationbetweendatasources.Ifyourdatainfrastructureisalreadystrugglingwiththemassiveamountsofdataitcontendswith,thenitwillonlybuckleunderthegreaterdataloadthatisonthehorizon.Enterprisesneedtostartbuildingtheirwayoutofthisdatadelugeiftheyhopetoturntransparencyintotrust.EmergingAItoolswilllikelyplayabigroleinyourenterprise’stransition.Theycanautonomouslyaggregate,de-duplicate,andauto-tagFromourhealthtoourhome,sensingtechnologiesincreasinglyplayanintegralroleinourdailylives.dataaswellasdootherkeydatapreparationtasks.139Recently,forexample,therestaurantreservationcompanyOpenTableusedClarifai’sauto-taggingfeaturetohelpemployeesmoderatecontentinimagesuploadedtoOpenTable’splatform.Afterintegratingthisauto-tagging,OpenTablenoticeditscontentmoderationbecame16timesmoreproductive;onaverage,eachmoderatorjumpedfrommoderating300to5,000photosaday.140IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier52#TechVisionTechnologyVision2023WhenAtomsmeetBitsAnothertechnologythatcanbolsteryourdatastrategyisaknowledgegraph,whichlinksrelateddatapointsandvisualizesthoselinks.Thesegraphsoftenincludesemanticlayers,ortextdescriptionsofthedata,whichmakeiteasiertofindwhatyouneed.StardogpartneredwithNASAtobuildaknowledgegraphoutofvariousdatasourcesaboutthemanufacturingofNASA’sSpaceLaunchSystemrocket.So,insteadofNASAengineersmanuallypullingindata,theycouldqueryaknowledgegraphtogetthedatatheysought,resultinginaten-foldincreaseintheirproductivity.141Importantly,emergingtoolsareallowingnon-engineerstotapintotechnologiesinthedatamanagementtoolboxaswell,allowingyourenterprisetobuildamoredata-forwardcompanyculture.Forinstance,self-serviceanalyticscanletemployees,regardlessoftheirtechnicalbackground,exploreyourenterprise’sdatatofindinsights.Thiscanbothempowerworkersandhelpsolvebusinessproblems.TaketheSeattleSeahawks,aprofessionalAmericanfootballteam.142Foryears,theNationalFootballLeague(NFL)VoiceoftheFansurveyfoundthatsomeSeahawkssupportershadofglobalexecutivesagreenewdataarchitecturesandstrategiesarerequiredtomanagethedramaticchangestotheirorganizations’datalandscapes.95%ahardtimehearinggamesintheteam’sstadium.Buttheteam’smanagementdidnotknowwherethosefanssattofixthegame’sspeakersthere.So,theSeahawksturnedtoTableau’sheatmappingtool.AfterinputtingtheirVoiceoftheFansurveydata,fourcornersoftheteam’sstadiumlitupinTableau’svisualization,showingwherethosefanswhocomplainedofpoorsoundqualitysat.TheSeahawkscouldreconfigurethestadium’saudiosystemwithoutbuyinganewone,savingmoneyandimprovingfanexperiences.Butisolatedtoolswon’tbeenough.Enterprisesneedtothinktoptobottomabouttheirdatamanagement.Fortunately,twoemergingdatamanagementstrategies,datameshanddatafabric,holdpromisetorevampyourenterprise.Theyeachhaveuniquebenefitsanddifferences,butunderscoringbothisstreamliningandde-siloingdataarchitectures.Withdatafabrics,thegoalistodefragmentanenterprise’sdataarchitecturebyleveragingautomationandmetadatatobuildasinglesourceoftruthacrossdisparatedatasources.Itisatop-IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier53#TechVisionTechnologyVision2023WhenAtomsmeetBitsdownapproachthatinstallsavirtuallayerontopofanorganization’svariousdatasourcesfortightlycontrolled,unified,datamanagement.Metaphoricallyspeaking,itislikebuildingazooaroundyourdata.Youaren’tchangingtheunderlyingdata,andinfactyou’retryingtopreservetheenvironments—butatthesametimeyou’rebuildingconsistencyacrosstheenclosures,betterdescriptionsaboutwhat’sinside,andamaptowhereeverythingissoit’sallreadilyaccessiblebyeveryone.Themajorboonhereishowthesinglesourceoftruthandautomationcandramaticallyincreaseproductivity.Onesurveyfounddatascientistsspend45%oftheirtimeondatapreparationtasks,includingdataloadinganddatacleansing.143Whilethesestepsmaybetime-consumingandtedious,theyarenecessarytoensuredataqualityforthingslikedatavisualizationormodeldevelopment.Adatafabricparadigmcanautomatedatatasks,savingtheenterpriseanditsemployees’valuabletime,thankstoanactivemetadatamanagementsystem.Gartnerpredictsthatby2025,“activemetadata-assistedautomatedfunctionsinthedatafabricwillreducehumaneffortbyathird,whileimprovingdatautilizationfourfold.”144Datameshisanotheremergingconceptwhichtacklestheprobleminadifferentway.Ifdatafabricstrytoasserttop-downmanagementoverdata,datameshtreatseachdatasourceasanindependentproduct.CoinedbyZhamakDehghaniin2019,datameshstressesdomain-specificexpertise,management,andgovernance.145Theownersofdatasourcesaredistributedandentrustedtomanagedatathemselves,withtheexpectationthattheyaretryingtoreducethefrictiontoaccessthatdata(typicallythroughtheuseofAPIs).Thisisparticularlyusefulforbusinessesthathavevarieddataneedsacrossdifferentenvironments.Forinstance,anoilandgascompanymayseektounderstandoffshoreextractiondataatonesite,thenpipelineefficiencydataatanother.So,insteadofsomethinglikeadatalakepoolinginformationtogether,adatameshparadigmcanhelpacompanyaccessdataacrosslocationsfrommultiplesources.Nomatterwhichdatastrategyyouendupwith(anditcanevenbeboth),datameshanddatafabric,aswellasthetechnologiesbehindthem,canhelpyourenterprisemanageitsdatabetter—andhavingDatameshisanotheremergingconceptwhichtacklestheprobleminadifferentway.asoliddatamanagementstrategyisnecessaryinthisneweraoftransparency.Thatsaid,theabilitytounlock“windowsoftransparency”isnotthesamethingasactuallyopeningthem.Indeed,manybusinesseswillchoosetokeeptheirinsightsunderlock-and-key—butasexemplifiedbyYelp,theymayfindtheirdataoutintheopenanyway,andsoon.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier54#TechVisionTechnologyVision2023WhenAtomsmeetBitsTheimplicationsThe“windowsoftransparency”thatarestartingtoemergereflectthebeginningofanewbusinesslandscapeeveryonewillsoonfindthemselvesoperatingin.Itwillreshapecustomerandpartnerrelationshipsandthevalueofdataandhowit’sgathered,creatingamarketwithclosertoperfectinformationthaneverbefore.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier55#TechVisionTechnologyVision2023WhenAtomsmeetBitsTothriveinthislandscape,enterprisesneedtoquicklystartrevisitingtheirdatatechnologiesandbuildtransparencyasthedemand(oropportunity)foritemerges.Buttechnologyisonlyhalfthestory.Businessesalsoneedtoshifttheirmindsetstowardsembracingtransparency,revisithowtheycalculaterisk,andthinkmoremultidimensionallyaboutthevalueoftheirdata.A“windowoftransparency”freesinformation—andunderyourmanagementthiscanbeapowerfulthing.Doesitmeantoyoushouldshareallyourdataallthetime?No,datamustbecollectedandusedresponsibly—privacyandconfidentialityareessentialandshouldalwayscomefirstinanydecisionssurroundingdata.Butcompaniesalsoshouldn’tbeoverlyconservative.Whenitcomestotransparency,therearevaluablegainstobefoundforbusinesses’internaloperations,forcustomers,andforthepublic,andyoudon’twanttomissout.Internal:Transparententerprisescanseemoreclearlythegearsthatmaketheirbusinessturn.Thatclaritybringsproblemsorinefficienciestolight,whichcanthenpavethewaytosolutions.Untilweknowthataproblemexists,wecan’tfixit.Andtransparencycanbethatilluminatingforcetostrengtheninternaloperations.Digitaltwinsare“windowsoftransparency”—andtheyareoneofthebestwaystoshinealightonabusiness’sinternalworkings.Whiletheymaynotbenew,theyaregettingbetterinsignificant,moretransparentways.Forinstance,BentleySystems’platformforbuildingdigitaltwinsofcriticalinfrastructuresystems,iTwin,nowincludesiTwinExperience,whichactsasa“singlepaneofglass”tointegrateandoverlayengineering,operations,andinformationtechnologydata.146Thisallowsownersandoperatorstomoreeasilyvisualize,query,andanalyzedigitaltwinsatdifferentlevelsofgranularityandscale,effectivelyempoweringthemtomakebetterinformed,moreactionabledecisions.Activelygeneratingtransparencycanalsohelpsatisfynewinternalrequirements.Increasingly,localregulationsacrossanumberofgeographiesareplacingmaximumsoncarbonemissions,andpenalizingcompaniesthatpassthatthreshold.147Itmeanscompanieshavetobeabletobothmeasureandreporttheiremissionstoensurecompliance.Tohelpbuildingowners,MeasurablandSingularityEnergylaunchedatoolthatquantifiesandmonitorsbuildings’CO2emissions.148Thistoolcandetermineabuilding’scompliancewithlocalregulations,givebuildingownersafinancialriskreportbasedontheircarbonemissions,andcreateadecarbonizationplanperbuilding.Makingcarbonemissionsvisiblewillnotonlyensureacompany’scomplianceandcommitmenttosustainability,butoverall,itwilltakeacityonestepclosertobeingcleanerandhealthier.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier56#TechVisionTechnologyVision2023WhenAtomsmeetBitsCustomer:Withcustomers,openingupgreatertransparencycanhelpenterprisesrevitalizeandenhanceexistingrelationships–andevenbecomeanavenueforsecuringnewones.Atatimewhentrustistopofmindforconsumers,thevalueoftransparencycannotbeunderstated.Approachthesenewdatademandsheadon,andyouwillbuildatrustedrelationshipwithcustomersandseethembecomeenthusiasticbrandchampions.Dataaboutcustomershaslongbeenvaluabletotheenterprise—nowitistimetomakeitvaluabletocustomersaswell.WantingtoemulatethesuccessofSpotifyWrapped,manyothercompaniesfromfitnesstrackerstonewssitesanddeliveryservicesexploredwaystopresentdatabacktocustomers.149Forexample,TheWashingtonPostlauncheditspersonalizedannualyear-in-reviewin2022,summarizingasubscriber’sreadinghabitstorevealtheiruniquereading“personality.”150Itremindsreadersofallthecontentthey’veenjoyedandthevaluetheygotfromThePost—andthereader’sunique“Newsprint”lookslikeafingerprint,readytobesharedonsocialmedia.Andothercompaniesprovideyear-enddatabacktotheircustomersinaggregate.Forinstance,accordingtoStrava’s2022YearInSport,cyclistsridingingroupsrodebothfartherandfaster,onaverage,thanthosewhorodesolo—hardproofthatitreallyisbeneficialtohaveatrainingpartner.151Beingtransparentwithcustomers,however,isalsoaboutallowingfeedbacktobesharedwithyou.ThinkingbacktoYelp,weknowpeople’sreviewscanshapeconsumerbehavior.It’sunderstandablethatenterpriseleadersarereluctanttoembracereviewssystemssincebadonescanhurtthebusiness—butnowtheassumptionmustbethatpeoplehavethatinformation.Inanenvironmentwithincreasingactivityfromfakeorbot-generatedreviews,itbenefitsenterprisestothinkabouthowtheydon’tshyawayfromtheconversation,butensureitisafairandaccuratedepiction.Trustpilotseekstorekindlecustomertrustbyrequiringthatreviewersshareanemailaddressandleavetheirreviewswithinoneyearofpurchasingaproduct.Moreover,Trustpilotemployscommunityflaggers,apaidhumanenforcementteam,andalgorithmicdetectiontogetridoffakereviews.152Trustpilotfoundthat74%ofconsumersaremorelikelytopurchasefromawebsitethatshowsTrustpilotreviews.153Verifiablereviewsarekeytobuildingacrediblebrandandloyalty.Foryearstherehavebeencallsforcompaniestoberesponsibleandopenaboutthedatatheycollectoncustomers.Nowtheexpectationisthatitwillbeatwo-waystreet.Enterprisesarebeinggiventheuniqueopportunitytonotjuststepawayfrompracticesthatleavecustomersskeptical,butalsoactivelyembraceonesthatreinforcetrust.Beingtransparentwithcustomers,however,isalsoaboutallowingfeedbacktobesharedwithyou.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier57#TechVisionTechnologyVision2023WhenAtomsmeetBitsSocietal:Oneofthebiggestdriversinthedemandfortransparencyishowbothenterprisesandpeoplealikearestartingtoconfrontproblemsthatarebiggerthananyonebusiness.Buttacklingcomplexmultivariateproblems,onceagain,demandsreliableandtransparentdata.Forexample,asmoreenterprisesbegintolookbeyondthelimitsofourplanetanduptowardsspace,theworldisquicklyrunningintotheproblemof“spacejunk.”Debrisfromsatellites,rocketlaunches,andmorearestartingtocrowdtheareasaroundourplanetcreatingallmannerofdifficulty,fromobstructingastronomerstointerferingwithfuturerocketlaunches.Normally,noenterprisewouldtreatthisas“their”problem,butPrivateer,aspacestartup,decidedtoshedlightonit.154Thecompanybuiltapubliclyaccessibleobjecttrackingplatformtotracetheorbitsandvelocityofalltheobjectscrowdingourplanet.Thehopeisthatbyquantifyingthisproblem,otherscanstartworkingonasolution—oratleaststopmakingtheproblemworseinthenearterm.What’sbecomeclearisthattransparencycandrivesignificantbenefitsforahugerangeofstakeholders.Whethercompaniesarelookingtoimprovetheiroperationalefficiency,transformtheirrelationshipwithcustomers,ortakepartinsolvingsomeoftheworld’smostchallenginginformation-relatedproblems,thisnewapproachandmindsetarounddataiskey.ofexecutivesreportacceleratedinnovationand56%reportgreatertrustwithcustomersastheleadingbenefitsofincreasedtransparencyfortheirorganizations.59%58#TechVisionTechnologyVision2023WhenAtomsmeetBitsThebottomline“Windowsoftransparency”arecoming,whetheryou’retheoneopeningthemornot.Thedecisioncompaniesneedtomaketodaycomesdowntowhethertheyseizethismomentandfindwaystotakeadvantageofthechangingdataecosystem,orifthey’llresistthesechangesandmisstheopportunitiesahead.Wenolongeroperateinanenvironmentthatacceptsopacity.Partners,customers,regulators,andmorearealldemandinggreaterinsightintoyourbusinessandindustrythanever—andifyoudon’tmeetthosedemands,someoneelsewill.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier59#TechVisionTechnologyVision2023WhenAtomsmeetBits#TechVisionAdayinournewreality:AlexToday’snews:satelliteimagesshowananomalyinoneofhersoybeanfields.Alexheadsouttoinspectthefield,andtoherdismay,findsdiscolorationonthecropleaves.She’sprettysuresheknowswhatitisbuttakesadozenphotosanduploadsthemforTerraWisetoconfirm.Later,duringacoffeebreakwithherfriends,TerraWisepingsherwiththeresults.Asshesuspected—it’ssoybeanrust.Thiscanspreadquickly,sotheyneedtoactfast.Usingwhatitknowsaboutthehistoryofthefield,aswellasleadingresearchonsoybeanrust,TerraWisegeneratesacustomfungicideplanfortheaffectedcrop,aswellaspreventativetreatmentforsurroundingfields.Italsosendsanalerttoneighboringfarms’AIassistants.Withluckandherneighbors’help,theymayallmanagetoavoidcroploss.Alexisafarmmanager,responsibleforhundredsofacresoflandintheMidwesternUnitedStates.It’salottokeeptrackof—butshe’snotdoingitalone.Everymorning,shestartsherdaywithabriefingfromTerraWise,herAIassistantforallthingsagriculture.TerraWiseregularlyaggregatesandanalyzesamassivestreamofdata,fromsoilsensors,dronefootage,farmequipment,satelliteimages,weatherforecasts,andmore,andalertsAlextothemostimportantinformation.soybeanrustinspectiondroneAIanalyticsdashboardsatellitesurveilance59TechnologyVision2023WhenAtomsmeetBitsIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontierIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier60#TechVisionTechnologyVision2023WhenAtomsmeetBitsTheradicaledges—andpossibilities—ofintelligenceGeneralizingAITechnologyVision202360IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontierIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier61#TechVisionTheDartmouthSummerResearchProjectonArtificialIntelligenceworkshop,consideredafoundingmomentforthefieldofAI,convenes1551956DaveRumelhart,GeoffreyHinton,andRonaldWilliamspublishalandmarkpaperonback-propagation-layingthefoundationformodernneuralnetworks1561986AlexNet,aconvolutionalneuralnetworktrainedonGPUs,achievesabreakthroughperformanceontheImageNetbenchmarktest1572012OpenAIisfounded1582015AlphaGobeats18-timeworldGochampionLeeSedol1592016GoogleintroducestheTransformerAInetworkarchitectureinapapertitled“AttentionIsAllYouNeed.”Transformersnowunderpinmostfoundationmodels1602017HuggingFacereleasesV1ofitsTransformersNLPlibrary1612019OpenAItrainsGPT-3(GenerativePre-trainedTransformer),whichbecomestheworld’smostsophisticatedlargelanguagemodel1632020TheEurpoeanUnionproposestheAIAct,thefirstlegislationconcerningAI,thatwouldban,regulate,orallowAIapplicationsbasedonanassignedriskcategory1622021ResearchersatStanfordUniversitypublishapapercoiningthephrase“foundationmodels”1642021ApieceofAI-generatedartwinsfirstplaceinthedigitalartscategoryattheColoradoStateFair’sfineartscompetition1662022OpenAIreleasesChatGPT,ahighlysophisticatedchatbot1682022TheBeijingAcademyofArtificialIntelligenceannouncesWuDao2.0;amultimodaltextandimagefoundationmodelwith1.75trillionparameters1652021DeepMindintroducesGato,ageneralpurposeagentfoundationmodelthatcanperformawiderangeoftasksacrossmultiplemodalitiesandembodiments1672022Severalnewsearchengineshaveemerged,featuringfoundation-model-based“quickanswer”servicesthatgiveusersdirectandthoroughanswerstoqueries2024Anewgenerationofvirtualassistantsisbuiltwithtransformer-basedfoundationmodels.Increasedadoptionisattributedtomoresophisticatedandnaturallanguageability2024Aconsumerelectronicsfirmintroducesearbudsthatuseanon-devicefoundationmodeltotranslateover100languagesinnear-realtime2025AprestigiousartmuseumopensagallerydedicatedsolelytoAI-generatedartwork202730%ofsocialmediaadsareautonomouslygeneratedusingfoundationmodels.Adsmuststillpasshumanreview202975%ofknowledgeworkersgloballyinteractwithanapplication,service,oragentpoweredbyfoundationmodelsdaily2030Auniversitydeploysageneral-purposefoodservicerobot,builtwithafoundationmodel,totakeonoddjobsinthecafeteria.Therobotlearnsnewtaskseasily,socanfillopenrolesasneeded2033TimelineGeneralizingAI61#TechVisionIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontierIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier62#TechVisionTechnologyVision2023WhenAtomsmeetBitsThebigpictureAIisstirringuptheinternet.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier63#TechVisionTechnologyVision2023WhenAtomsmeetBitsWhenOpenAIrevealedChatGPT—apowerfulnewchatbot—inlate2022,peopleclamberedtotestit.169Theyaskedcomplicated,open-endedquestions,requestedpoemsandessayswithobscuretopicsandstyles,andgotimpressiveandsometimeshumorousresults:inonecase,instructionsforremovingapeanutbuttersandwichfromaVCRwritteninthestyleoftheKingJamesBible.170Then,notevenfourmonthslater,OpenAIreleasedGPT-4,thegreatlyanticipatednextgenerationofitsAIsoftware,whichisevenmorecreative,andcanrespondtobothimageandtextinputsandevenmorenuancedinstructions.171,172Andbeforeallthis,theinternetwasfloodedwithAI-generatedart.Text-to-imagegeneratorslikeStabilityAI’sStableDiffusion,Midjourney,andOpenAI’sDALL-E2,stunnedpeoplebyrespondingtowrittenpromptswithphotorealisticimages.“TwocapybaraswaltzinginthestyleofMonet”wouldgetyouprettymuchthat.Infact,thiswaveofAI-generatedcontentissoadvanced—andmovingsoquickly—thatit’sdrivingcontroversy.Argumentsoverfairnessinartcompetitions,theethicsofmimickingartists’styles,legalrisks,andtheimpactonpeople’slivelihoodshaveflared.Andyet,whilerelevancetotheartindustryisclear,businessesinotherfieldsmaystillseeitasmerenovelty—andthey’remakingamistake.ThisgeneratedcontentispartofoneofthebiggeststepchangesinthehistoryofAI:theintroductionofpretrainedmodelswithremarkabletaskadaptability,whichwillrevolutionizehowandwhereenterprisesacrossindustriesuseAI.ItbeganwithalandmarkinnovationinAImodelarchitecturebyGoogleresearchersin2017.173Sincethen,techcompaniesandresearchershavebeensupersizingAI,increasingthesizeofmodelsby10,000timesandthesizeoftrainingsetstoo.Theresult:powerful,pretrainedmodels,oftencalled“foundationmodels,”thatofferunprecedentedadaptabilitywithinthedomainsthey’retrainedon,beitlanguage,images,orthestructureofproteins.Withthisadaptability,foundationmodelscancompleteawidevarietyoftaskswithoutneedingtask-specifictraining.What’smore,companiesIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier64#TechVisionTechnologyVision2023WhenAtomsmeetBitsbuildingfoundationmodelsaregivingthirdpartiesaccessthroughAPIsorbyopensourcingthem,puttingtheseadvancedmodelsinanyone’shands.Thisisnoeverydaytechnologyadvancement.WhilefoundationmodelsarenottheonlyareaofAIresearchthat’sgrowing,themagnitudeoftheirpotentialimpactandthespeedatwhichtheycanbedeployedisdrivingthemtothetopofcompanies’innovationagendas.Withthem,businessescanstarttoapproachmanytasksandchallengesdifferently,shiftingfocusfrombuildingtheirownAItolearningtobuildwithAI.OnecompanytakingadvantageofthisisCarMax.CarMaxisusingGPT-3,alargelanguagemodelandpredecessortoGPT-4,toimprovethecar-buyingexperience.174Knowingthatthere’samassiveamountofinformationpotentialcarbuyersmaywanttoreadthroughbeforemakingapurchasedecision,CarMaxusedMicrosoft’sAzureOpenAIServicetoaccessapretrainedGPT-3modeltoquicklyreadandsynthesizeover100,000customerreviewsforeveryvehiclemake,model,andyearthattheysell.Fromthesereviews,themodelgenerated5,000easy-to-readsummaries—ataskthatCarMaxsaidwouldhavetakenitseditorialteam11yearstocomplete.Otherorganizationsarealsoexperimentingwithfoundationmodels,adaptingthemfortasksrangingfrompoweringcustomerservicebots,togenerativeproductdesign,toautomatedcoding.Andthemodelsareadvancingfast,withcompaniesacrossindustriesquicklydiscoveringnewwaystousethem.AsfoundationmodelsbroadenandextendwhatwecandowithAI,theyarelettingcompaniestransformhuman-AIinteractionandbuildanentirelynewgenerationofAIapplicationsandservices.Itisimperativeforeverybusinesstopayattentiontofoundationmodels.TobepartofthisnewgenerationofAIapplicationsandleveragethesemodelstodrivenovelbusinesssolutionsandofferings,companiesneedtounderstandtheirstrengthsandcapabilitiesandtrackhowtheyareadvancing—startingtoday.ThebedrockofAIisshifting.Willyouloseyourfooting—orenduponhigherground?ofglobalexecutivesareeitherveryorextremelyinspiredbythenewcapabilitiesofferedbyAIfoundationmodels.96%IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier65#TechVisionTechnologyVision2023WhenAtomsmeetBitsThetechnologyTounderstandwhat’shappeninginthisneweraofAIandsetyourselfuptobuildanewgenerationofAIapplications,wefirstneedtoexplorewhatmakesfoundationmodelsdifferent.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier66#TechVisionTechnologyVision2023WhenAtomsmeetBitsAnewcategoryofAIOpenAI’sGPT-3,whichwasreleasedin2020,wasthefirstfoundationmodeltocapturewidespreadpublicattention—forgoodreason.Itwasthelargestlanguagemodelintheworldthenanddroveabreakthroughinthefield.Itdemonstratedcapabilitiesnoonehadseenbefore,teachingitselftoperformtasksithadneverbeentrainedon,andoutperformingmodelsthatweretrainedonthosetasks.Intheyearssince,manymoresupersizedmodelshaveappeared.CompanieslikeGoogle,Microsoft,Meta,andBaiduhavecreatedtheirownlargelanguagemodels.175,176,177,178Andsomehavestartedbuildinglargemultimodalmodels—liketheaforementionedGPT-4andtext-to-imagegenerators—whicharetrainedonmultipletypesofdata(liketext,image,video,orsound)andtoidentifytherelationshipsbetweenthem.179InanefforttodefinethisnewclassofAI,researchersfromtheStanfordInstituteforHuman-CenteredArtificialIntelligencecoinedtheterm“foundationmodel”inAugust2021.180TheygenerallydefinedthemaslargeAImodelstrainedonavastquantityofdatawithsignificantdownstreamtaskadaptability.Inpracticetoday,thesemodelstypicallyleveragetransformermachinelearningmodelsandhaveamassivenumberofparameters—rangingfromhundredsofmillionstotrillions.Whatmakesthemsogamechanging,isthatthey’rebroadlytrainedacrossadatamodality(ormultiplemodalitieslikelanguageandimage),ratherthanonaspecifictask,andcanlearntocompletenewtaskswithinthesedatatypeswithminimalornoextratraining.Inotherwords,theyhavegeneralistcapabilitieswithintheirdomains.DeepMind’sGatoisoneofthemostexcitingexamplestodate.ThecompanycallsGatoa“generalistagent”becauseitismultimodalandcancompleteover600differenttasks.181,182UsingasingleAImodelwithfixedweights,itcanchat,captionimages,playAtarivideogames,stackblockswitharoboticarm,andmore.Additionally,itcanlearnthesevarioustaskssimultaneouslyandswitchbetweenthemwithouthavingtoforgetpreviousskills.Forcontext,AlphaZero—anolderDeepMindmodelknownforplayingchess,Go,andshogi—hadtounlearnhowtoplaychessinordertoplayGo.InanefforttodefinethisnewclassofAI,researchersfromtheStanfordInstituteforHuman-CenteredArtificialIntelligencecoinedtheterm“foundationmodel”inAugust2021.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier67#TechVisionTechnologyVision2023WhenAtomsmeetBitsFoundationmodelworkingsTherearetwokeyinnovationsmakingthisnewwaveofAIpossible.Thefirstistransformermodels,introducedbyGoogleresearchersin2017.183OneofthenewestclassesofAImodels,transformersareneuralnetworksthatidentifyandtrackrelationshipsinsequentialdata(likethewordsinasentence),tolearnhowtheydependonandinfluenceeachother.Theyaretypicallytrainedviaself-supervisedlearning,whichforalargelanguagemodelcouldmeanpouringthroughbillionsofblocksoftext,hidingwordsfromitself,guessingwhattheyarebasedonsurroundingcontext,andrepeatinguntilitcanpredictthosewordswithhighaccuracy.184Thistechniqueworkswellforothertypesofsequentialdatatoo:somemultimodaltext-to-imagegeneratorsworkbypredictingclustersofpixelsbasedontheirsurroundings.Thesecondinnovationisscale—significantlyincreasingthesizeofmodels,andsubsequently,theamountofcomputeusedtotrainthem.Thesizeofamodelismeasuredinparameters,whicharethevaluesorweightsinaneuralnetworkthataretrainedtorespondtovariousinputsortasksincertainways.185Generallyspeaking,moreparametersletsamodelsoakupmoreinformationfromitstrainingdataandmakemoreaccuratepredictionslater.ButwhatOpenAIdemonstratedwithGPT-3isthatvastlyincreasingthenumberofparametersinatransformermodel,andthecomputationalpowerputintotrainingit,leadsnotjusttohigheraccuracybutalsotheabilitytolearntasksthemodelwasnevertrainedon.Thisnovellearningability—alsoknownasfew-shotandzero-shotlearning—meansthatfoundationmodelscansuccessfullycompletenewtasksgivenonlyafewornotask-specifictrainingexamples.DeepMind’sFlamingo—an80Bparametermultimodalvisual-languagemodel—isespeciallygoodatthis.186Ina2022paper,DeepMindresearchersdemonstratedhowFlamingocanconductfew-shotlearningonawiderangeofvisionandlanguagetasks,onlybeingpromptedbyafewinput/outputexamplesandwithouttheresearchersneedingtochangeoradaptthemodel’sweights.Insixof16taskstheytested,Flamingosurpassedstate-of-the-artmodelsthathadbeentrainedonmuchmoretask-specificdata,despitenothavinganyre-trainingitself.OneofthenewestclassesofAImodels,transformersareneuralnetworksthatidentifyandtrackrelationshipsinsequentialdata(likethewordsinasentence),tolearnhowtheydependonandinfluenceeachother.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier68#TechVisionTechnologyVision2023WhenAtomsmeetBitsWhilefoundationmodelshavealreadypushedtechnologicalboundaries,it’simportanttorecognizethatthefieldischangingquickly.Stanford’s2022ArtificialIntelligenceIndexReportfoundasignificantuptickintheannualnumberofglobalAIpublicationssince2017.187AccordingtoCBInsights,2022sawrecordinvestmentsingenerativeAIstartups,with$2.6billioninfundingacross110deals.188Andinearly2023,MicrosoftannouncedthenextphaseofitspartnershipwithOpenAIthroughamultibilliondollarinvestment.189Totrulyunderstandtheimpactfoundationmodelswillhaveontheirindustriesandbusinesses,companiesneedtocarefullytracknewdevelopments.Oneofthemostsignificantwaysfoundationmodelsareevolvinghastodowiththedatatypesthey’retrainedon—whichrightnowarelimited.Mostoftoday’sfoundationmodelsarelargelanguagemodelstrainedonnaturallanguage,andevenmultimodalmodelsaretypicallylanguage-and-imageonly.Butsomeareworkingtoexpandtomoredatamodalities.Thiscanmeanbuildingstandalonefoundationmodelsfornewkindsofdata.Meta,forinstance,developedaprotein-foldingmodel—alargelanguagemodelthatlearnedthe“languageofprotein”—thatacceleratedproteinstructurepredictionsbyupto60x.190AndaresearchteamfromtheUniversityofTexasatAustin,theIndianInstituteofTechnologyMadras,andGoogleResearch,proposedGeneralizableNeRFTransformer(GNT),atransformer-basedarchitectureforNeRFreconstruction.191,192ANeRF(NeuralRadianceField)isaneuralnetworkthatcangenerate3Dscenesbasedononlypartial2Dviews—andexperimentingwithtransformerstogenerate3Ddatalikethiscouldhavebigmetaverseimplications.Otherorganizationsareworkingtoincorporatemoredatatypesintoasinglemodel.TakeMicrosoft’sFlorence,afoundationmodelbuiltforgeneral-purposecomputervisiontasks.193Whileitwastrainedonalargedatasetofimage-textpairsandhasonlyatwo-towerarchitecture,combiningonelanguageencoderandoneimageencoder,itscreators97%ofglobalexecutivesagreeAIfoundationmodelswillenableconnectionsacrossdatatypes,revolutionizingwhereandhowAIisused.FutureadvancesinfoundationmodelsIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier69#TechVisionTechnologyVision2023WhenAtomsmeetBitsextendeditslearningabilitytovideotaskswithaproposedvideoadapterbuiltofftheimageencoder.Extendingtothisadditionaldatatypeisakeysteptowardacomputervisionfoundationmodelthatcangeneralizeacrossreal-worldvisiontasks—andcoulddriveapplicationsinsecurity,healthcare,andmore.Anothersignificantareatotrackiseffortstomakebuildinganddeployingfoundationmodelseasier.Rapidlygrowingcomputerequirements,andtheassociatedcostsandexpertiseneededtohandlethisscale,arethebiggestbarrierstoday.TheamountofcomputeneededtotrainthelargestAImodelshasgrownexponentially—nowdoublinganywherefromevery10monthstoevery3.4months,accordingtovariousreports.194,195Andevenafteramodelistrained,it’sexpensivetorunandhostallofitsdownstreamvariationsasitgetsfine-tunedtohandledifferenttasks.Intoday’scloudcomputingsetups,it’sslowtoloadfoundationmodelseachtimethey’reneededbutexpensivetokeepmanymodelsonline.Anyscale—aunicornthatrecentlyraised$199million—isworkingtolowerthesebarriers.196AnyscalewasfoundedbyagroupofUCBerkeleyresearcherswhodevelopedRay,anopen-sourceframeworkthatimprovesaccesstofoundationmodelsbymakingiteasiertoscaleanddistributemachinelearningworkloads.It’scurrentlyusedtotrainthelargestAImodelscomingoutofOpenAI,likeChatGPT.197Cohere,astartupbuildinganNLPdevelopertoolkit,alsousesRaytotrainlargelanguagemodels.198AndIBMisusingittoimplementzero-copymodelloading,wheretheystoremodelweightsinsharedmemory,anduseRaytoinstantlyloadandredirectclusterresourcestowhatevermodelanapplicationrequiresinthemoment.199Thisfreesusersfromneedingtotunethenumberofmodelvariationstheykeeploadedinmemory,andisexpectedtoleadtomuchsimplerfoundationmodeladaptationanddeployment.Thenovelcapabilitiesoffoundationmodels—andtheseongoingadvancesinthetechnology—haveledsomeinthecommunitytoseethemasasteptowardartificialgeneralintelligence(AGI),anAIsystemcapableoflearninganyintellectualtaskthatahumancanlearn.Onlytimewilltellifthetechnologiesandmethodsbehindfoundationmodelsareenoughtoachievesomeformoftrulygeneralintelligenceinthefuture.Nevertheless,thelevelofgeneralizationfoundationmodelshavealreadyachievedwithincertaindatatypesishugelysignificantandmorethanenoughtorevolutionizehowandwhereenterprisesuseAI.Totrulyunderstandtheimpactfoundationmodelswillhaveontheirindustriesandbusinesses,companiesneedtocarefullytracknewdevelopments.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier70#TechVisionTechnologyVision2023WhenAtomsmeetBitsTheimplicationsThequestionnowforbusinessesshouldn’tbewhetherthesemodelswillimpacttheirindustry,buthow.Foundationmodelsarewidelyadaptableandcouldtechnicallybeusedforawidevarietyoftasks—sothedecisionscompaniesmakearoundwhereandhowtodeploythem,whatproblemstoattempttosolvewiththem,andwhatproblemstoaddresswithdifferenttechnologies,arewherecompetitivedifferentiationwillbefound.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier71#TechVisionTechnologyVision2023WhenAtomsmeetBitsUsingfoundationmodelsfortherightpurposesstartswithunderstandingwhattheytrulychange.Thisgoesbeyondtechnicalcapabilities—it’saboutwhatthesemodelsletbusinessesdothattheycouldn’tdobefore.Therearetwomajorbenefitshere.First,theyhavethepotentialtodeeplytransformhuman-AIinteraction.LookathowsomearecallingChatGPTthefutureofsearchandknowledgeretrieval.200Itcanwritepoemsandessays,debugcode,andanswercomplicatedquestionsbecauseit’strainedonbillionsofexamplesoftextpulledfromtheinternet.201Anditrememberspreviousconversations,soitcanreviseorelaborateonresponses,makinghuman-machinecommunicationmoresophisticatedandnatural.Thisisimportant.Becausemanyfoundationmodelsare(orcontain)alargelanguagemodel,theyusenaturallanguageastheirinterface.It’sabigpartofwhyfoundationmodelsaregivingrisetoanewgenerationofAIapplications:peoplecaneasilyengagewiththem.Frame,forinstance,isusingalargelanguagemodelcapableofgeneratingcodetohelpteachersdesign3Dmetaverseclassroomssimplybydescribingwhattheywantintheroomoutloud.202Andthey’renottheonlyonesthinkingalongtheselines.JensenHuang,CEOofNvidia,hasalsosaidheexpectslargelanguagemodelstobeacoretechnologyforgenerating3Dimagesandshapestopopulatethemetaverse.203Anotherwayfoundationmodelsarechanginghuman-AIinteractionisbytransforminghowworkisdone.Googleusedafoundationmodeltodevelopacodecompletiontool,whichover10,000engineerstestedforathree-monthperiod.204Theresultsshowedthatcodingiterationtimewasreducedby6%.Thepotentialofthesemodelstotransformworkflowsandimproveproductivity,eveninhighlycomplextasks,isundeniable.Andsoon,companiesmaystarttousetheminmuchmorevariedways,augmentingtasksallacrossproductdevelopment,businessprocesses,andmore.CharacterizingthebenefitsoffoundationmodelsIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier72#TechVisionTechnologyVision2023WhenAtomsmeetBitsThesecondmajorbenefitisthatfoundationmodelsareopeningthedoortonewAIapplicationsandservicesthatweredifficultorimpossibletobuildbefore.Forinstance,lackoftrainingdataisamajorissueformostorganizationslookingtoexpandtheiruseofAI.Butwithzero-andfew-shotlearningabilities,pretrainedfoundationmodelsmayhelpcircumventthislimitation.Foundationmodelsrequiremassiveamountsofdataupfront,whichishandledbytheircreators.Butonceamodelistrained,organizationscanadaptittoarangeofdownstreamtasks,buildingnewcapabilitieswithjustafewexamplesorfine-tuningamodelwithjustasmalltrainingset.RatherthaneverynewAIapplicationrequiringmonthsofeffortandinvestment,organizationswillbeabletocreateanddeploythemmuchmoresimply.IBM,forinstance,hasbeentransitioningsomeofitsWatsonportfoliotousefoundationmodels.205Theyfoundthatwithpretrainedlanguagemodels,WatsonNLPcouldtrainsentimentanalysisonanewlanguagewithonlyafewthousandsentences,atrainingsetahundredtimessmallerthanwhatpreviousmodelsrequired.Overaboutayear,thecompanywasabletoexpandWatsonNLPfrom12languagesto25.Theintersectionofdataandfoundationmodelspresentsaninterestingirony.Thesemodelsrequirehugeamountsofdatafortraining,butoncetrained,cangeneratelimitlessquantitiesofsyntheticdata.Thiscouldbeusefulformanyorganizationsconstrainedbythelackofreal-worldlabeleddata,theneedfordatafromedgecases,ortheneedtopreservedataprivacy.Syntheticdataisprimedtoplayanimportantroleintrainingandvalidatingautonomousvehicles,systemsthatworkwithhealthrecordsorfinancialdata,andmuchmore.Ontheflipside,ascompaniesdevelopnewfoundationmodels,theymayalsorunoutoftrainingdata.Mostlanguageandimagemodelsrelyonhugeamountsofwebdata,andorganizations’abilitytoincreasemodelsizedependsonfindingnewdatasources.Additionally,developingfoundationmodelsfornewmodalitiesmayrequirehugeamountsofhard-to-obtaindata.Syntheticdata,perhapsevenfromearlyfoundationmodels,couldbeapowerfultoolforbuildingthesenewmodels.Sidebar:SyntheticdataandfoundationmodelsIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier73#TechVisionTechnologyVision2023WhenAtomsmeetBitsMultimodalfoundationmodels’abilitytorecognizemultipledatatypesandidentifytherelationshipsbetweenthemisalsopushingtheenvelopeofwhatAIiscapableof,enablingpowerfulnewsystems.GPT-4,forexample,ismultimodalandacceptsbothimageandtextinputs,meaningthatifsomeoneweretoshowitapictureoftheinsideoftheirrefrigerator,itcouldcorrectlyidentifytheitemsinside,suggestmealsthatcanbemadewiththoseingredients,andthenprovidestep-by-stepcookinginstructions.206AndMetahaslongseenthevalueofanAIsystemthatcaninterpretcontentonitsplatform—especiallywhenitcomestodetectinghatespeech.Butthisisataskthat’shistoricallybeendifficultformachinesbecausepeopletendtocommunicateinmultimodalwaysontheseplatforms(usingtextandimagetogethertotellajoke,forinstance).SoMetahaslaunchedaseriesoffoundationandmultimodalAIprojectstohelpthemanalyzedifferenttypesofcommunication—liketext,image,andvideo—inconjunction.ThecompanycreatedtheHatefulMemesdatasettoaddresstheshortageofpubliclyavailabletrainingdataforclassifyingmemes;itdevelopedFLAVA,amultimodalfoundationmodelthatworksacrossdozensoftasks;anditbuiltOmnivore,amodelthatcanoperateacrossimages,video,and3Ddata,doingthingslikedetectingcontentinbothvideosandimages.207,208Thoughmultimodalfoundationmodelsarestillrelativelyfew,andmostofthemaretext-to-imagegenerators,it’sexcitingtoimaginethepossibilitieswe’llhaveinthefuture.Whatwillwebeabletodowhenmultimodalmodelsconnecttext,sound,image,video,3Dspatialdata,sensordatafromindustrialequipment,environmentaldata,ormanyothertypesofdata?Earlyopportunitiesmaystartwithgeneratingmarketingimagesandadcopybutcouldgrowintosophisticatedautogeneratedcodeandnewwaystosearchandaccessinformation.AnalystsmightuselanguagetoaskanAIsystemtodescribepatternsacrossthousandsofsatelliteimages.ApieceofindustrialequipmentmightuseanAIsystemtotranslatedatafromdozensofsensorsintoarepairprocedureforamechanic.OrmultimodalAImighthelpdrasticallyimprovethepathplanningandperformanceofroboticarms.Thoughmultimodalfoundationmodelsarestillrelativelyfew,andmostofthemaretext-to-imagegenerators,it’sexcitingtoimaginethepossibilitieswe’llhaveinthefuture.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier74#TechVisionTechnologyVision2023WhenAtomsmeetBitsOncecompaniesgraspthebenefitsoffoundationmodels,thequestionshiftsfromwheretheydrivevaluetohowtodeploythem—andoneofbiggestreasonsfoundationmodelsaresoexcitingisthatmostcompanieswon’tneedtobuildtheirown.Asinglefoundationmodel’sabilitytocompletemanydownstreamtasksiscreatingaparadigmshiftinthebusinessofAI.LargetechcompaniesandresearchorganizationsthathavebuiltpretrainedfoundationmodelsarestartingtopositionthemasplatformstounderpinnewAIapplications.Theyaremakingfoundationmodelsavailableviaopen-sourcechannelsorviapaidaccessthroughAPIs—meaningthatdownstreamorganizationsdon’tneedtobuildtheirownfoundationmodelsbutcanfocusonbuildingontopofexistingones.Justastheemergenceofcloudplatformstransformedconversationsfrom“HowdoIbuildmyownclouddatacenter?”to“WhatcanIbuildwiththepubliccloud?”foundationmodelsareshiftingconversationsfrom“HowdoIbuildmyownAI?”to“WhatcanIbuildwithAI?”GoingbacktoGPT-3—thisfoundationmodelisthemostestablishedasaplatformtoday.OpenAItransitionedfromanon-profittocapped-profitcompanyin2019andreleasedtheOpenAIAPIasitsfirstcommercialproductin2020.209,210ItgrantscustomersaccesstoGPT-3andmakescustomizingoradaptingthemodelforanewtaskassimpleasshowingitsomenewexamplesorprompts.Ninemonthsafterlaunching,thecompanyreportedover300applicationsusingtheAPI.211By2022,thatnumberwasinthethousands,withGPT-3poweringfeatureslikecopywriting,websitebuilding,chatbots,andmore.212,213Additionally,thestartupHuggingFaceisgrowinginpopularityasahubforfoundation,transformer,andothermachine-learningmodels.Thecommunityplatformoffersmanypretrainedmodels,allowingdeveloperstoworkwithnewAImodelswithoutneedingtocollectdataortrainthemthemselves.Theplatformispopularwithindiedevelopers,butmajorcompanies—includingIntel,eBay,Pfizer,andBloomberg—arestartingtouseitaswell.214HuggingFrombuildingAItobuildingwithAIIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier75#TechVisionTechnologyVision2023WhenAtomsmeetBitsFacecloseda$100millionfundingroundata$2billionvaluationinMay2022tohelpitbecomethepremierlocationforbuildingwithpretrainedAImodels.A“middlelayer”isalsostartingtoappearalongsidefoundationmodelplatforms,offeringserviceslikefine-tuningthemodelsformorecustomuse.Thoughfoundationmodelsarepretrainedandhighlyadaptable,somedownstreamtasksmayrequiremorespecifictraining,andfine-tuningmeanstrainingitonnew,task-specificdatatochangeitsoutput.Microsoft,forinstance,ispackagingandsellingGPT-3capabilitiestocustomers,integratingitintoitslow-codeappdevelopmentplatformPowerApps,andofferingcustomersaccesstothemodelalongwiththeenterprise-gradesecurity,compliance,reliability,anddataprivacyassuranceofAzure.215ThechangesfoundationmodelshavebroughttotheAIlandscape—andtheirexpectedimpactonbusinesses—shouldn’tbeunderstated.Withplatformsmakingitincreasinglysimpletoadaptpre-trainedmodelsforvariousAIneeds,companiesmaydeployAIsolutionsfarmorereadilythanbefore.Andwithfoundationmodelsexpandingintonewdatamodalities,companiescanbuildtrulynovelapplicationsthatwouldn’thavebeenpossiblebefore.Thisisafast-movingfield,soit’stimetostartimagininghowthesemodelsmaytransform—ordisrupt—yourbusiness.Thisisafast-movingfield,soit’stimetostartimagininghowthesemodelsmaytransform—ordisrupt—yourbusiness.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier76#TechVisionTechnologyVision2023WhenAtomsmeetBitsEveryyearAIplaysabiggerroleincompanies’innovationagendas,operations,customerinteractions,andmore.Butnow,organizations’carefullyconstructedstrategiesneedtoberethoughtwithfoundationmodelsinmind.Thismeansdiscoveringthemostappropriateapplicationsforfoundationmodelsinyourorganization,planningtoaccessthebroaderfoundationmodelecosystem,andbuildingthetalentpipelinethatwillbeneededtocreate,maintain,orintegratethesemodels.Firsttoidentifytherightroleforfoundationmodelsinyourorganization,it’snecessarytounderstandtheirbestusecases.TherearemanyAIapplicationsthatworkwithdatatypesnofoundationmodelcanhandleyet.Additionally,someusecasesthatafoundationmodelcouldfeasiblyattemptarestillfundamentallybetterservedbynarrowAI,whichistrainedspecificallyforataskratherthanacrossamodality.216Clearlydefinedproblemslikepredictivemaintenanceandmedicalimageanalysis,forinstance,areareaswherenarrowintelligencemaybethebetterchoice.Beyondthat,someapplicationsrequirespecialcharacteristicsthatotherapproachesarebettersuitedto.On-deviceAImayrequireextremelowpoweroperationortheabilitytorunanAImodelfullyofflinesodatacanstaywiththedeviceratherthanbeingsenttothecloud.What’smore,foundationmodelshavesomecharacteristicsthat—fornow—makethemquestionableforcertainsituations.Thisisaddinganentirelynewdimensiontoenterprises’securityefforts.Forinstance,biasinfoundationmodelsisacommonconcernduetohomogenizationaswellasthefactthatmanyaretrainedonlargedatasetsfromtheinternet.Historicdatasetsthatexcludedcertainpopulations,people,anddemographicscanleadtoundesirableoutcomes.Andsomecompanies’earlyeffortsevenfoundmisinformationwasaffectingtheoutputsofthesealgorithms.Whenthesamefewmodelsareusedasthebasisformanydownstreamapplications,thenanyissuesintheoriginalmodelsmaypropagatethroughouttherest.TherehavebeeneffortsfromthemakersoffoundationmodelstoofglobalexecutivesagreeAIfoundationmodelswillplayanimportantroleintheirorganizations’strategiesinthenext3to5years.98%ConstructinganewAIstrategyIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier77#TechVisionTechnologyVision2023WhenAtomsmeetBitscorrectforsomeofthesebiases.GPT-3,forinstance,wasgivenanextraroundoftrainingonamorecurateddatasetafterreligiousbiaswasdiscovered.217Butevenso,businessesshouldcarefullyconsiderriskslikethiswhendeterminingnotonlyiftheycanuseafoundationmodel,butwhethertheyshould.Asbusinessesnarrowdownwheretousefoundationmodels,theynextneedtodecidehowtheywillaccessthesemodelsandwheretheywillsitinthefoundationmodelecosystem.Thebaselayerofthisecosystemconsistsoforganizationswiththeexpertise,accesstodata,andcomputinginfrastructuretotrainnewfoundationmodels—butnoteveryoneneedstofunctiononthislevel.Formany,decisionswillbearoundhowdirectlytheyworkwithpre-trainedmodels.Forinstance,anotherlayeroftheecosystemwillbecompaniesthataccessfoundationmodelsviaAPIsormodelrepositoriesandbuildonthemtocreatetheirownapplicationsandservices.Forsimpleapplications,developerswillbeabletoleveragethetransferlearningoffoundationmodelsbysimplybuildingtheUIandinterconnectsaroundthemodel,whileinmoreadvancedcases,developersmightleveragefine-tuningtohonethefoundationmodeltoaspecificapplication.Thisapproachcreatestheopportunityforwideexperimentationthroughouttheorganization,aswellasthechancetodevelopB2Bfoundationmodelofferings.Butagain,noteveryonewillwanttodothis.Evenwithnaturallanguageofferinganeasy-to-useinterface,somesoftwareengineeringknowledgeisneededtosuccessfullybuildapplicationsaroundfoundationmodels.Companieswithoutthoseskillsetscanstillbenefitfromthetechnologythough,andtheymakeupthethirdlayeroftheecosystem.InthewakeofOpenAIandothersturningtheirmodelsintoplatforms,awaveofcompanieshavestartedofferingnewB2Bproductsandservices.WhethertheyusefoundationmodelstopowerB2Btools,enhancetheirownservices,orbuildcustomapplicationsforclients,thesecompaniesaremakingiteasierthaneverforanyonetocapitalizeonfoundationmodelcapabilities.Finally,athirdwaybusinessescanstartreworkingtheirAIstrategieshastodowithtalent.AsfoundationmodelsemergeandofferapowerfulbaselineforIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier78#TechVisionTechnologyVision2023WhenAtomsmeetBitsbuildingAIapplications,AIoperationswillshiftfrombuildingmodelstobuildingontopofmodels.Talentwiththeskillstotakefoundationmodels,adaptthemtobusinessneeds,andintegratethemintoapplicationswillbecomeincreasinglyimportant.Justastheadoptionofthecloudshiftedbusinessneedsfromtalentwithdatacenterexpertisetocloudarchitects,foundationAIislikelytoreshapethenatureofAIoperationstoo.Yourtalentstrategyadjustmentsshouldn’tstopthere,however.Someofthebiggestchallengeswithfoundationmodelswillbediscoveringthenewpossibilitiestheycanbringtoyourorganizationandthenmonitoringtheiroutputandbehavior.Andwiththesemodelsevolvingquickly,it’sanongoingchallenge.Thiswillneedtobeacross-organizationeffort—andwhobettertodiscoverhowaprocesscanbeimprovedorhowanexperiencecanbeelevated,andthensupervisehowafoundationmodelisusedtosolvethosechallenges,thanthepeopleworkingonthem?Whetheritmeanstrainingeveryemployeeonfoundationmodelcapabilities,orcreatingteamsdedicatedtointegratingthesemodelsintodifferentpartsofthebusiness,bringingyourwiderorganizationintothisneweraofAIiscritical.Foundationmodelsareintheirinfancy,butoverthenextdecadetheirimpactwillgrowtobeoverwhelming.Theycoulddrivenewdatapractices,transformingthenatureofknowledgesharingintheorganization.Theycouldbegame-changingfordigitalstrategies,writingsophisticatedcodeandpoweringnovelofferings.Theycouldtransformstrategyandbusinessplanning,forecastingheadcountneedsorshiftsincustomerdemandwithgreatereaseandaccuracythanwecanimagine.Andforthosethatbuildtheirownfoundationmodels,theycouldbringindustry-shiftingadvantages—newtoolsforscientificdiscovery,newmethodsforengineering,ornewindustry-specificAIagents.Whatifyourbusinessbuildsthemodelthatchangeseverything?Whetheritmeanstrainingeveryemployeeonfoundationmodelcapabilities,orcreatingteamsdedicatedtointegratingthesemodelsintodifferentpartsofthebusiness,bringingyourwiderorganizationintothisneweraofAIiscritical.#TechVisionTechnologyVision2023WhenAtomsmeetBits#TechVisionTechnologyVision2023WhenAtomsmeetBitsThebottomlineThearrivaloffoundationmodelsisoneofthebiggeststepchangesinAIhistory—andnoenterprisecanignorethem.Thesesupersizedmodels,withunprecedentedadaptabilitytonewtasks,areforcingenterprisestorethinktheirAIstrategies—fromhowtheyaccessAItowhatapplicationsareevenpossible.Already,companiescanusemodelsavailabletodaytoexperimentandbuildnovelapplicationsmoreeasilythanever—andasthetechnologyadvances,theopportunitieswillonlykeepgrowing.TolearnmoreabouttheimpactofgenerativeAIonbusiness,readAccenture’slatestreport,AneweraofgenerativeAIforeveryone.79IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier80#TechVisionTechnologyVision2023WhenAtomsmeetBitsTechnologyVision2023WhenAtomsmeetBits#TechVision80Adayinournewreality:BenWearinghisARglasses,Benexaminesa3Ddiagram,rotatingtheimagetoseeeveryside.He’safoodscientistatMeat4All—astartupaimingtoproduceaffordablesyntheticprotein.Rightnow,he’stryingtodesignanewscaffoldfortheirmeatcultures,onethathehopeswillimprovethetextureoftheirnewestsubstitutemeatproduct.He’sworkingwiththecompany’sAIsystem,whichgeneratesseveralnovelproteinstructures,allofwhichcouldbeusedasscaffoldingmaterial,andhavethepotentialtoimprovetexturewithoutoverlycompromisingtheflavorofthemeat.Afterexaminingthem,Benselectsthethreebestoptions.Then,heaskstheAIsystemwhichofthethreewouldhavethelowestcarbonimpact.It’sabroadquestionwithalotofcontributingfactors,fromwherematerialsaresourcedtodifferencesinthesynthesisprocess.TheAIsystemcomesbackwithacarbonimpactanalysisforeachone,andthedifferencesareslight.ButBenknowsthatonceMeat4Allisproducingthesescaffoldsatscale,slightdifferencescanmeanalot.BenARglasses3DdiagramofsyntheticproteinIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontierTechnologyVision202381ThebigbangofcomputingandscienceOurforeverfrontierTechnologyVision202381IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontierIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier82#TechVisionBycombiningformaldehydeandphenol,BelgianchemistLeoBaekelandcreatesthefirstentirelysyntheticplastic2181907TheManhattanProjectbeginsanddrawsattentiontotheimpactofscienceontechnology2191942PhysicistsatBellLabsachieveasemiconductorbreakthrough,leadingtotheinventionofthetransistorandtransistorizedcomputers220,2211946ThefirstU.S.spacestation,Skylab,launches.Itwillbethesiteofnearly300technicalandscientificexperiments2221973PeterShordevelopsanalgorithmthatcouldbreaktraditionalencryption,ifapowerfulenoughquantumcomputerexisted2231994Bringingtogetherexpertcomputerscientists,engineersandbiologists,theHumanGenomeProjectsuccessfullysequences92%ofthehumangenome2242003Boeing,VirginAtlanticandGEAviationconductthefirstcommercialflightwithamixtureoftraditionalandbio-derivedaviationfuel2252008DARPAlaunchestheLivingFoundriesprogramwhichaimstoharnessbiologicalsystemstoproducecomplexmoleculesfordefense-relevantapplications2262010NASA,Google,andtheUniversitiesSpaceResearchAssociationpurchaseaD-WaveTwotostudytheintersectionofquantumcomputingandAI2272013Tocreatebetterautomotivetires,GoodyearexperimentsonsilicaparticleformationaboardtheInternationalSpaceStation2282019HostedatOakRidgeNationalLaboratory,theFrontiersupercomputerbecomesthefirstexascalecomputer,accordingtotheTop500list2302022ComputationalimmunologyandmRNAtechnologyleadtotheCOVID-19vaccines-thefastestvaccineseverdeveloped2292020Theaveragepricetosequenceahumangenomereaches$600,downfrom$10,000in2012,thanksinparttoadvancesinmolecularchemistry2322022Anewquantumcomputingalgorithmpropelsabreakthroughinsolid-statebatteryproduction2025Inanationalsustainabilitypush,Indiaunveilsasyntheticallyderivedmicrobewhichincreasesefficacyofplasticbreakdown2026Morethan50%ofnewcarssoldareelectric,20%havesolid-statebatteries2030Usingquantumcomputing,scientistscreateanewmethodtospeedupgreenhydrogenproduction.Globalhydrogenusegrows3x2027Q-Dayarrives,andsystemsprotectedwithRSAencryptionarenolongersecure2032AlargeagriculturecompanyusesgenerativeAItodesignanewbacteriathatcapturesCO2andconvertsitintocompoundsforfertilizer20311billionpeoplehaveatleast10%oftheirgenomesequencedandnowbenefitfromimprovementsinpersonalizedmedicine2033ThefirstprivatespacestationiscompletedandwillhostbothNASAandprivatescientificresearch2033DeepMindreleasesover200millionproteinstructurepredictionsderivedfromthedeeplearningalgorithmAlphaFold2312022TimelineOurforeverfrontier#TechVision82IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontierIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier83#TechVisionTechnologyVision2023WhenAtomsmeetBitsThebigpictureWorldWarIItaughtusanimportantlessonabouttherelationshipbetweenscienceandtechnology—onethatguidedinnovationeffortsfordecadesafter.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier84#TechVisionTechnologyVision2023WhenAtomsmeetBitsDuringthewar,sciencewashavingclearandsignificantimpactonmilitarysuccess,throughthecreationofnewtoolsandweaponslikeradarandtheatomicbomb.233Andneartheendofit,alandmarkreporttotheU.S.president,called“Science,theEndlessFrontier,”madethecasethatsupportingscientificresearchwoulddrivetechnologiescriticaltothenationaleconomy—anditledtosignificantgovernmentandcorporateinvestmentsinscience.Theperiodofinnovationthatfollowedallbutprovedthistheory.LookatBellLabsandtheinventionofthetransistor.Thefirstpatentforaproposedfield-effecttransistorwasfiledin1925,butascientificbreakthroughwasneededtomakeatransistorthatactuallyworked.234In1946,BellLabsphysicistsmadethatbreakthrough,advancingcriticalunderstandingofelectronmobilityinsemiconductors.Theybuiltthefirstworkingtransistorin1947,andsevenyearsafterthat,thefirsttransistorcomputerwasmade—foreverchangingtechnologyandtheworld.235Butthe“sciencedrivestechnology”ethoswasn’tthewholestory.HighinvestmentinandfocusonscienceduringandafterWorldWarIIcertainlyacceleratedtechnologicaldevelopment—buttechnologyalsobegantorapidlyacceleratescience.Rockettechnologydevelopedformilitaryapplicationsquicklybecamethefirsthuman-madeobjectstoreachouterspaceandwouldsendhumanitytothemoonlessthantwodecadeslater.236Combatradarwasadaptedtofocusonweatherpatterns,sparkingthefieldofmeteorology.Andthehuntforcheapalternativestorubberledtothedevelopmentofnewmaterials.237Therelationshipbetweenscienceandtechnologyisabi-directionalfeedbackloopthatcanbeexercisedtopowerfuleffect,pushingtheboundsofthepossible.Butrecently,withthegrowthofcomputing,(digital)technologytookcenterstage,capturingthefascinationofenterpriseseverywhere.Whiletechnologycertainlystillacceleratedscientificdiscovery,enterpriseswerelargelycontenttoleavethatinthehandsofresearchersandspecificindustries.WeforgotthelessonsfromBellLabs,thespacerace,andothers.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier85#TechVisionTechnologyVision2023WhenAtomsmeetBitsNowthat’sstartingtochange.Moreenterprisesarewideningtheirinnovationeffortstofocusontheentiretyofthefeedbackloopandareseeingjusthowpowerfullydisruptivetheintersectionofscienceandtechnologycanbe.TheCOVID-19pandemiccreatedglobalpressureandurgencytoinnovatetoadegreethatwehadn’tseenindecades,andleadersrespondedwithhighinvestmentinemergingtechnologiestohelpthemdrivescienceanddelivernewsolutionsatbreakneckspeed.Itwasaperiodofmassiveinnovationcompression,theimpactofwhichwillcontinuetobefeltforadecadeormore.ConsiderthedevelopmentofCOVID-19vaccines.InlateDecember2019,thefirstCOVID-19caseswerereportedbyChinesehealthofficials.ByJanuary10,scientistshadpublishedthegenomicsequenceofSARS-CoV-2,andbymid-March,vaccinetrialshadbegun.238,239Bytheendof2020,multiplemRNAvaccinesforCOVID-19demonstratingover90%efficacyhadbeencreated.Thesevaccinesweredevelopedatunprecedentedspeed(often,thisprocesscouldtakeoveradecade),largelyduetoadvancesincomputationalimmunologyusedtodevelopvaccinecandidates—andvirtualcommunicationandcollaborationtechnologiesprovedcriticalaswell.240,241Whatthisachievementdemonstratedisthatcertaintechnologiescouldacceleratethescience-technologyfeedbackloopfasterthananyoneknew.Thedigitaltechnologiesthathadbeenamplifyingbusinesscapabilitiesforyearswerefocusedonanewdomain:science-ledinnovation.Itradicallyreshapedourapproachtoscientificinnovation,fromhowquicklywecanachieveresultstoitspotentialimpactonenterprisesandourlives—abigbangofcomputingandscience.Now,withtheworldlargelyemergingfromthecrisis,we’reputtingthoselessonstowork.Everyorganizationneedstostartrethinkingtheirinnovationstrategieswithaneyetohowtechnologyisdrivingscience,andhowsciencewillinturndrivetechnologyincomingyears.Thespeedofthescience-technologyfeedbackloopisoneofthebiggestvariablessettingthepaceofinnovation,andinvestmentsinthetechnologiestoaccelerateitareofglobalexecutivesagreethecombinatorialeffectofscienceandtechnologydrivingeachotherisleadingtocompressedinnovationinsciencetech.96%IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier86#TechVisionTechnologyVision2023WhenAtomsmeetBitsonlyincreasing,bringingnewinnovationpossibilities—andnewopportunity—toeveryone.It’sawide-rangingimperative,butalreadythereareafewkeydomainswherethescience-technologyfeedbackloopishavinggreatimpactandwherebusinessescanstarttofocustheirinnovationefforts.Onesuchareaissyntheticbiology,anditsoriginisaprimeexampleofjusthowpowerfulthescience-technologyfeedbackloopcanbe.TomKnightisconsideredthegodfatherofsyntheticbiology,buthebeganasacomputerscientist.242WhiledesigningoneofthefirstsiliconretinasforhisPhD,hebeganinvestigatingMoore’sLaw,ortheobservationthatthenumberoftransistorsonanintegratedcircuitdoubleseverytwoyears,makingcomputepowergrowexponentially.HesawthateventuallyMoore’sLawwouldcometoanend—becausetransistorswouldbesosmallthatplacingadozenorsoatomscorrectlywouldbeimpossibleinthesiliconmanufacturingprocess.ThiswaswhatledKnighttobiochemistry,becauseherecognizedthatifproteinsnaturallyandaccuratelyself-assemble,perhapstherightbio-moleculescouldtoo.Atthesametime,Knightrealizedthewaysinwhich,conversely,biologycouldbenefitfromengineeringprinciples,likeusingmodularizationandabstractiontobuildbiologicalsystems.243Andindeedthisapproachhasexpeditedthegrowthofsyntheticbiology—afieldnowpoisedtodisruptmaterialsandmanufacturingasweknowthemtoday.Besidestheemergentfieldofsyntheticbiology,othernotabledomainsarealsoseeingmajoradvancesfromthescience-technologyfeedbackloop.Forinstance,next-generationcomputingmethods,enabledbythecombinationofincreasedcomputingpowerandnewcapabilitiesinspiredbyscience,arestartingtounlocknewscientificpossibilitiesinareaslikecomputationalchemistryfornewmaterialsandenergysolutions.Advancesinrocketandsatellitetechnologiesarealsoredefiningthespaceeconomy,enablingmorescienceexperimentsinspacelabs,aswellasthestudyofdeepspaceandEarthitself.Advancesinrocketandsatellitetechnologiesarealsoredefiningthespaceeconomy,enablingmorescienceexperimentsinspacelabs,aswellasthestudyofdeepspaceandEarthitself.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier87#TechVisionTechnologyVision2023WhenAtomsmeetBitsThepoweroftechnologyisextendingbeyondIT(informationtech)andOT(operationaltech)toanewST(sciencetech)domain.Everyonewillbeimpactedbysciencetech,whetherornottheyworkinthephysicalsciencesorbuildthetechnologiestoacceleratethosefields.Newtechnologicaladvancesincomputing,rocketsandsatellites,andbiotechwilldrivescientificadvancementsinmaterialsandenergy,Earthandspace,andsyntheticbiology—whichinturnwilltransformthetechnologiesthatenterprisescanbuild,aspartofavirtuouscycle.Everythingfromwherecompaniescandeliversolutions,towhattheirproductsandpackagingandotherphysicalassetsaremadeof,couldchange.Andbeyondthat,thesocietalneedforafasterscience-technologyfeedbackloophasneverbeenmorecrucial.Theworldfacesunprecedentedchallengesinmedicine,thesupplychain,andclimatechange,andweneedbetterandfastersolutionsfromscienceandtechnology.Reorientingforanewperiodofscienceandtechnologyaccelerationwillnotbeeasy.Itwillrequiredeepunderstandingofhowtechnologyisacceleratingthesciences,andhowthesechangeswillimpactyourbusiness.Anditwillrequirefastactiontoo—innovationcompressionhasalreadybeenachallengeforthepastfewyears,andthepaceofinnovationisonlygettingfaster.Areyoureadyforit?Everyonewillbeimpactedbysciencetech,whetherornottheyworkinthephysicalsciencesorbuildthetechnologiestoacceleratethosefields.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier88#TechVisionTechnologyVision2023WhenAtomsmeetBitsThetechnologyManyoftoday’semergingtechnologieshavethepotentialtoacceleratethescience-technologyfeedbackloop—soit’scriticalforcompaniestostartidentifyingwhichonescouldhavethebiggestpotentialimpactsonscientificadvancement,andinturn,whichscientificadvancementscouldhavethebiggestimpactsonfuturetechnologies.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier89#TechVisionTechnologyVision2023WhenAtomsmeetBitsWhiletherearemanyareaswherescience-technologyfeedbackloopscandriveinnovation,wewilldiscussthreeearlydomainswherethecycleissignificantlyacceleratingandweareseeingitsimpactalready:materialsandenergy,Earthandspace,andbiology.MaterialsandenergyMajortechnologicaladvancesincomputingarelaunchinganeweraofcomputationalchemistry,amajordriverbehindmaterialandenergyinnovation.244Withaccesstogreatercomputepowerandnewcomputingparadigms,chemistswillbeabletodomorecomplexandmoreaccuratemolecularsimulationsthaneverbefore,deepeningscientificunderstandingandpushingtheboundsofnovelmaterialdevelopment,energysolutionstoaddressclimatechange,andmore.Considerthis:performingmorethanonequintillionoperationspersecond,asupercomputerinChinaappearstohavebeenthefirsttobreaktheexascalebarrierin2021.245AndinMay2022,asupercomputerfromtheU.S.OakRidgeNationalLaboratorybecamethefirsttoofficiallydemonstrateexascaleperformance,accordingtoresearchersfortheTop500,arankingoftheworld’smostpowerfulhigh-performancecomputers.246Withplansformoreexascalemachinesaroundtheworld,thisscaleofcomputepowerwilltransformscience,andcomputationalchemistryinparticular.Theimportanceofthisknowledgeshouldn’tbeunderstated.Takingstrategicadvantageofthesedevelopmentswillbewhatletsenterprisestransformtheirbusinessesincomingyears,andultimatelythefuturesoftheirindustries.Chemistswillbeabletorunfastersimulationsoverlargermolecularsystemsandoverlongerlengthsoftime,providingneededinsightsintochemicaltheorytoreducethegapsbetweenvirtualsimulationsandreal-worldexperimentalfindings.Whiletherightcodewouldstillbeneededtotakeadvantageofthiscomputingpower,someprogramslikeNWChemExarealreadybeingdeveloped—inthiscasetoruncomplexmolecularsimulationstobetterusecatalyticmaterialstomoresustainablyproducebiofuels.247Theimpactthatpowerfulsupercomputersarestartingtohaveonthesciencesisundeniable—butit’snotlimitless.There’stheendofMoore’sLawtokeepinmind,meaningthatthegrowthofcomputepowerisslowing—andtotheextentthatitgrows,costsmaybecomeprohibitivelyhigh.Assuch,methodstoovercomethesecomputinglimitsarealsogrowing,includingmovingtoentirelynewcomputingparadigmslikequantumcomputing.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier90#TechVisionTechnologyVision2023WhenAtomsmeetBitsQuantumcomputershavea“natural”advantage(overclassicalcomputers)insimulatingquantummechanics,whichgovernsthebehaviorofmolecules,atoms,andelectrons.Assuch,itiscontributingtothefieldofchemistry,inperhapsthenearest-termapplicationofquantumcomputers.248Thoughcomputationalspeedupsmaycomewithquantumcomputers,whattheyprovideinthiscaseisanadvantageouslevelofaccuracyinmodelingdistinctpartsofachemicalreaction—andthisenhancedunderstandinghasmanypotentialapplications.Forinstance,HyundaiispartneringwiththequantumcomputingstartupIonQtoanalyzeandsimulatebatterymaterials—inthiscaselithiumoxide,containedinlithium-airbatteries.249Usinghybridalgorithmsthatleveragecomputingbybothclassicalandquantumcomputers,theycanimprovethechemicalmakeupforgreaterefficiencyandeliminatepossiblesourcesofwaste.ofglobalexecutivesbelievenext-generationcomputingwillbeamajordriverofbreakthroughsintheirindustryoverthenextdecade.95%Buildingsupercomputersandquantumcomputersisnotcheap,butexperimentingwiththemissignificantlycheaperthanbefore,thankstocloudplatforms.FireflyAerospace,forinstance,isastartupthatreliesoncloudsupercomputingtodoadvancedsimulationstosavemassiveamountsofmoneyonprototyping,enablingthemtobuildarockettogotothemoon.250Andwhilequantumcomputingstillneedstimetomature,it’sclearthatthesecomputershaveamajorroletoplayhelpingcompanieseffectivelydrivesciencetechnologyfeedbackloopsandacceleratematerialsandenergyinnovation.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier91#TechVisionTechnologyVision2023WhenAtomsmeetBitsEarthandspaceMovingovertoEarthandspaceinnovation—sincetheInternationalSpaceStation(ISS)begantohouseitsfirstastronauts,nearly3,000scienceexperimentshavebeenconductedinspace,takingadvantageofitsuniqueconditionslikemicrogravitytobetterunderstandhowthingswork,orofitsvantagepointtolookdownatEarthoroutintothedepthsofspace.251Now,advancesinrocketandsatellitetechnologiesaremakingspacemoreaccessibleandusefulforscientists—acceleratingwhatwecanlearnaboutfluidphysics,diseases,materials,climatechange,andmore,toimprovelifeonEarth.Spaceprogramswerehistoricallyveryexpensive,limitingaccesstoonlyafewnationsandtheirgovernments.Recentlyhowever,duetocheapercomponentsandgrowthintheprivatesector,costshavefallenprecipitously.252Accordingtoa2022Citireport,between1970to2010,theaveragelaunchcostremainedrelativelysteadyat$16,000/kgforheavypayloadsand$30,000/kgforlightpayloads.253Thenin2010,SpaceXlaunchedFalcon9withapayloadcostof$2,500/kg,roughlytentimescheaper—andgettingcheaperstill.254Relatedly,thecostofsatelliteshasalsodecreaseddrastically.Now,ratherthancosthundredsofthousandsofdollarstogetintoorbit,itcantakeonlyacouplethousand—alsothankstotheirsmallersize.255,256Alltheseloweredcostsarefuelingthespaceindustry.257In2021,spaceinfrastructurecompaniessawrecordhighprivateinvestmentsat$14.5billion(up50%from2020),andtheindustryoverallisexpectedtogenerateover$1trillioninannualsalesby2040.258,259Withthislevelofgrowthandinvestment,therewillonlybecheaperandmorefrequentflightstospace,leadingtomorepeopleandmorescientificresearchthereaswell.260Already,thestartupTitanSpaceTechnologiesissending“bothcodeandcrew”onspacemissionstoconductexperimentsintheirdigitalspacelabs,essentiallyenabling“space-as-a-service”forcompaniesthatwanttoperformtheirownexperimentsinspace.261ThisisexcitingforthosewhomightwanttotakeadvantageoftheIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier92#TechVisionTechnologyVision2023WhenAtomsmeetBitsuniquepropertiesofspace—includingmicrogravity,extremetemperatures,oravacuum—forresearchintoadvancedmaterials,pharmaceuticals,andmuchmore.Thishashistoricallybeenkeytogaininggreaterscientificknowledge—sincetheearlydaysofspaceexperimentation,scientistshavebeenabletolearnmuchmoreaboutinsulin,forinstance,becauseitwascrystallizedinspace(inmicrogravity,proteincrystalsgrowlargerandmoreuniformly).262Satelliteadvancesarepushingscienceforwardtoo.Launchedin2018aboardaSpaceXFalcon9,NASA’sTransitingExoplanetSurveySatellite(TESS)isexpandingscientists’knowledgeofthegalaxy.263By2020,TESShadimaged75%oftheskyand,insodoing,found66newexoplanetsand2,100candidates.264Nowonanextendedmission,itsimagingcadencehasbeenincreasedtobetterfindEarth-likehabitableplanetsnearreddwarfstars—andithasfoundoneofparticularinterest(TOI700d)already.265TurningourattentiontoEarth,satelliteslikeJason-3takeoceansurfacetopographymeasurementsforscientiststobetterunderstandsealevelriseandclimatechange,aswellastopredictsevereweatherevents.266Andnewbusinessmodelslike“satellite-as-a-service”and“spacedata-as-a-service”areprovidingevengreateraccesstospace,whichcouldbeleveragedbyresearcherstoo.267Rocketandsatellitetechnologyadvanceshavedrivendownthecostbarrierstospace,fuelingaburgeoningspaceeconomythatishavingrealandsignificantimpactonthesciences,openingthedoorstospacelabsforconductingnovelexperimentsandsatellitesforfindingnewworldsandunderstandingmoreofourown.Ashistoryhasshownusbefore,sciencediscoveriesinspaceleadtotechnologicalprogressonEarth—andperhapsnowinspaceaswell—aspartofaproductivescience-technologyfeedbackloop.Now,advancesinrocketandsatellitetechnologiesaremakingspacemoreaccessibleandusefulforscientists—acceleratingwhatwecanlearnaboutfluidphysics,diseases,materials,climatechange,andmore,toimprovelifeonEarth.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier93#TechVisionTechnologyVision2023WhenAtomsmeetBitsBiologyLastly,this“bigbang”ofcomputingandscienceisgivinglifetoanentirelynewfield:syntheticbiology.DrivenforwardbytechnologicaladvancesinDNAsequencingandsynthesisandtechnology-inspiredbestpractices,syntheticbiologycombinesengineeringprincipleswithbiologytocreateneworganismsorenhanceexistingones.Itspromiseliesinwhatthoseorganismsarethenabletodoorproduce,fromnewfoodstopharmaceuticals,fuels,andmore—therebychangingmanufacturingprocessesandproductsasweknowthemtoday.ArecentarticlepublishedinScientificReportpredictsthatsyntheticbiologymaybethenextmajoradvancementfollowingmicroelectronicsandtheinternet,andoneofthemainreasonsforthisisthatthecostofbothDNAsequencingandDNAsynthesis(the“reading”and“writing”ofgeneticcode)ishalvingroughlyeverytwoyears.268Togetasense,in2001,thecosttosequenceahumangenomewas$100million,anditisroughly$600today(andcouldbeaslittleas$100nextyear);tenyearsago,genesynthesiscostabout$10/basepairandisnowabout$0.10/basepairtoday.269,270Thesefallingcostshavehadasignificantimpactonsyntheticbiology—becausebothDNAsequencingandDNAsynthesisarecriticaltotheprocess.Toillustrate,let’simagineacompanywantstoproducesyntheticvanilla.First,theygothroughtheir(nowmuchlarger)databaseofDNAsequencestodeterminewhichmightbemostlikelytogeneratethatflavor.271Next,themostpromisingare(morecheaply)synthesizedandputintocells,likeyeastcells.Theneworganismsstartproducingchemicals,andwhicheverisbestisincreasedinproduction.Withthismanufacturingprocessdetermined,thecompanyissettoproducesyntheticvanillaflavoring.Ofcourse,mostbusinessescannotdothisontheirown—buttheycouldworkwithacompanylikeGinkgoBioworks,aone-stop-shopforsyntheticbiology,todoso.GinkgoprovidesthetechnologyIntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier94#TechVisionTechnologyVision2023WhenAtomsmeetBitsplatform,includingbothitscodebaseandfoundries(labs),foritscustomers.272Itscodebaseconsistsofcells,enzymes,andgeneticprograms,whichorganismengineerscanusetostartprojects.Andthefoundriesareitsfactories,whichcombineautomation,analytics,andsoftwaretoautomateandscaleorganismengineering.Notsurprisingly,Ginkgo’swebsitedrawsmanyparallelstosoftwareengineering,anditsplatformhasbeenlikenedtocloudplatformslikeAWS.Anotherexampleofsyntheticbiologybeingdrivenbytechnology-inspiredpracticescomesfromtheBioBricksFoundation.Theorganizationisattemptingtoestablishanopen-sourcesyntheticbiologymovement,inspiredbytheopen-sourcesoftwaremovement,throughprogramslikebionet,whichisanopentechnologycommonsforscientiststosharetheirmaterialsinthenameofcollaboration,standardization,andsharingforscience.273,274Inshort,syntheticbiologyasweknowittodayhasclearcomputerscience-andengineering-inspiredorigins.Thougharelativelynewfield,syntheticbiologyisbeingusedalready.It’swell-knownforaidinginthedevelopmentoftheCOVID-19vaccine,butit’salsousedbyBoltThreadstomakebio-basedleatherandUpsideFoodstoproducesyntheticmeatlikeduck,beef,andchicken.275,276,277Syntheticbiologytechniquescanalsobeusedtomakedyes,cosmetics,andspices.Notonlyarethesenewandinnovativeproducts,buttheyaremoreenvironmentallyfriendlyandsustainablethantheiralternatives.FrommaterialsandenergytoEarthandspaceandbio-innovation,thesethreedomainsarejustafewearlywaysthesciencetechnologyfeedbackloopisalreadyatwork.Andeachofthemhashugepotentialimpactonthefuturesofcompaniesandindustries.Asmorecompaniesstarttorecognizethatandtakeadvantageoftechnology-drivenscientificadvances,thebuildingblocksofinnovationwillstarttochange,andstragglerswillquicklybeleftbehind.DrivenforwardbytechnologicaladvancesinDNAsequencingandsynthesisandtechnology-inspiredbestpractices,syntheticbiologycombinesengineeringprincipleswithbiologytocreateneworganismsorenhanceexistingones.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier95#TechVisionTechnologyVision2023WhenAtomsmeetBitsTheimplicationsNowthatwe’vecoveredsomeofthemostsignificantscience-technologyfeedbackloopstoday,weneedtothinkabouthowtheseadvanceswillimpactourworld—andwhatisnewlypossibleinit.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier96#TechVisionTechnologyVision2023WhenAtomsmeetBitsIt’scriticalthatbusinessesunderstandthescopeofthisnewfrontier,ortheyriskfailingtosetacompetitiveinnovationstrategyandpaceforthenextyears.Whiletheacceleratedfeedbackloopwillnotbethesoledriverofnewinnovations—purelytechnology-drivenIT,OT,anddigitalprojectsarestillveryimportant—STisstilltoobigforanyonetoignore.Theimpactwillbefeltbyeveryone.Todoubledownonexactlyhowbigthisimpactcouldbe,considerwhatitcouldmeanforsomeoftheworld’sbiggestproblems,likepandemics,climatechange,andthesupplychain.Ifthey’renotalready,thesewillbesomeofbusinesses’biggestproblemsincomingyearstoo,meaningtheyshouldhaveavestedinterestinsciencetechnologyandthevastinnovationopportunitiesthatcomewithit.In2020,ofcourse,businesseslearnedthatpandemicsareaseriousthreattopeopleandthemselves.We’vediscussedhowtheCOVID-19pandemicpromptedswiftactiontodevelopavaccine—andcomputationalapproachesvastlyincreasedthespeedatwhichthiswaspossible.278Stillthough,newCOVID-19variantscontinuetoemerge.Whileourvaccinescanbeupdated,researchersatPennStateCollegeofMedicineareworkingonabettersolution—avaccinethatcouldprotectagainstallexistingandfuturevariantsofthevirus—andsciencetechisattheheartoftheirefforts.279Unlikeexistingvaccinesthattargetthereceptorbindingdomain(RBD),theseresearchersaretargetingthevirusthroughimmunogens—designedusingcomputationalbiologytoidentifyregionsofthespikeproteinthatremainthesamedespitemutations,andtestedforstabilityusingcomputersimulations.Giventhatpandemic-capablediseasesareincreasinginfrequency,thespeedofvaccinedevelopmentandthebreadthofimmunitythosevaccinesprovidewillbeofcriticalimportancethroughouttheworld.280Movingontoclimatechange,ofallthechallengestheworldfacestoday,thismaybethebiggest.Sustainabilityiscertainlyonmostbusinesses’radars,andalloftheareaswe’vediscussed,frommaterialsandenergytospaceinnovationsandsyntheticbiology,havethepotentialtocontributetosustainabilityinasignificantway.Forexample,Accenture,theIrishCentreforHigh-EndComputing(ICHEC),andIonQcollaboratedtocreateascalablesoftwareplatformforchemistrysimulationonquantumcomputers.ItisusedtocalculatetheenergyneededtobreakchemicalbondsinmoleculeslikePFAS—helpingtofindmechanismstodestroyPFAS,whicharehuman-madecarcinogenic“foreverchemicals”thatpollutetheenvironment.281AndLanzaTechisusingsyntheticbiologytomakemicrobesthattakecarbonemissionsandturnthemintovaluablerawmaterialslikefuelsandchemicals.282Andconsiderhowsyntheticbiologyfacilitiescanbestrategicallyplacednearfossilfuelplantsorother...ofallthechallengestheworldfacestoday,climatechangemaybethebiggest.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier97#TechVisionTechnologyVision2023WhenAtomsmeetBitswasteheavysitesforfuel—thiswouldmaketheirrawmaterialsourcesabundantandnolongerpotentiallyvulnerabletoglobalsupplychainissues.Inaddition,becausethesefacilitiesproduceuniquematerials,aproductlikevanillanolongerhastocomealmostentirelyfromMadagascarbutcanbemadesyntheticallyanywhereintheworld.Finally,relativelysmall-scalemanufacturingofthingslikesyntheticproteinsourcesiseconomicallyviable(noneedforyearsofanimalfarming)—meaningthatagain,demandsonglobalsupplychainsarereduced,asaretransportationemissions.283Ourworldfacesimmensechallenges,manyofwhichhavebeendifficultandpainfullyslowtoaddressinthepast.Butthisistheultimatepromiseofsciencetech—asmorecompaniesinvestinthetechnologiesneededtoacceleratescience,morecompanieswillbeabletousethosescientificdevelopmentstocreatenewsolutionsfasterandmoreeffectivelythaneverbefore.Itwon’thappenovernight,butthebenefitsarenecessaryandworthwhile,andhavethepotentialtobeinvaluableforthebusinessesthatgetinvolved.ofexecutivesbelievesciencetechcapabilitiescouldhelpaddresssocietalgrandchallengesofhealth-relatedissuesanddiseases,while75%believesciencetechcapabilitiescouldalsohelpaddresspoverty/inequality.83%IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier98#TechVisionTechnologyVision2023WhenAtomsmeetBitsFirst,businessesthatwanttobemoreactiveparticipantsindevelopingthesenext-generationtechnologies,andthesciencestheydrive,shouldrecognizethatcollaborationisthekey.Next-generationcomputingtechnologieslikequantumcomputingarenotonlyadvancedandcomplexbutrequireskillsthatarehardtofindandinhighdemand.Therefore,organizationsacrossindustriesandsectorsarepursuingquantumcomputinggoalstogetherthroughconsortiums.Forexample,inJapan,theQuantumInnovationInitiativeCouncil(QIIC)aimstoaccelerateJapan’squantumleadershipandconsistsofmembersfromacademicinstitutions,government,andbusinesseslikeIBM,Toyota,andToshiba.284Andthissortofcollaborationcanalsobeachievedthroughstrategicpartnerships.Forinstance,thequantumalgorithmdesignplatformClassiqhaspartneredwithColdQuantaforitscoldatomtechnology,NVIDIAforitscuQuantumsoftwaredevelopmentkit,andNTTDATAforaspecificapplicationofquantumcomputingtocreditriskanalysis.285GettingstartedtodayStill,gettinginvolvedinthesciencetechnologyrevolutioniseasiersaidthandone.Manynewtechnologiesarealreadyatworkacceleratingthescience-technologyfeedbackloop,andthechangesthiswillbringtoourinnovationlandscapearecomingfast.Compoundingthechallengeisthatunlikethedigitalrevolution,companiesarestartingatwildlydifferentlevelsofmaturity.Someenterprises,likethoseinpharmaceuticalsorchemicals,havelong-standingscience-ledinnovationpractices.Thesecompanieswillknowthevalueofmaintainingtheirpositionontheleadingedge,exploreandinvestinemergentdigitaltechnologiesthatwillacceleratetheirpractices,andjumpontheopportunitythatsciencetechposestobuildpartnershipsandbridgesintobrandnewindustries.Othercompanieshaveneverconsideredthemselvesinvolvedinthesciencesatall.Forthem,therearethreehigh-levelactionstotaketodaytosetthemselvesupforsuccessinthisnextphaseofinnovationcompression.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier99#TechVisionTechnologyVision2023WhenAtomsmeetBitsquantumcomputingyettobeexplored,thissortofexperimentationisbeneficialtobusinessesandthefieldasawhole.Andintermsoftryingnewthingsinspace,AmazonrecentlypartneredwiththeItaliansatellitecompanyD-OrbitandtheSwedishintelligentautomationcompanyUnibaptoconducta“first-of-its-kind”experimentinspace—runningasuiteofAWSsoftwareonasatelliteinlowEarthorbit.290TheAWSsoftwarewastrainedtoreviewimagesandsendonlythemostusefultoEarth,improvingtheproductivityofthesatelliteinspaceandreducingtheamountoftimetogetinsightsontheground.Finally,businessesalsoneedtobeawareofandpreparefortherisksinthisnewfrontier.Advancesandincreasedaccesstosyntheticbiologycouldleadtodangerouslaboratoryleaksorbiologicalweaponsabuse,forinstance.291Thishighlightstheneedforsubstantialbiosecuritystrategies.Andwhileclearerlegalregulationsarestillneeded,companiescantaketheirownstepsnowtoimplementpoliciesandgovernanceplansandviewbiosecurityasaninvestmentratherthanaburden.Intheemergingfieldofsyntheticbiology,therearemanypartnershipsaswell.Forinstance,thesyntheticbiologycompanyCodexishaspartnershipswithpharmaceuticalcompanieslikeMerck,GSK,andNovartiswhouseitsCodeEvolver®proteinengineeringplatformtodevelopenzymestoenhancetheirpharmaceuticalmanufacturingprocesses.286AndGinkgoBioworksisworkingwithMotifFoodWorkstodevelopnoveldairy,meat,andplant-basedproteins—andbringthesenewfoodproductstomarketfaster.287Thesecondwaybusinessescanpreparethemselvesistofindwaystostartexperimentingwithnewscience-driveninnovations.Fortunately,thisisgettingeasierwiththemanyadvancedtechnologyandscienceplatformsbeingcreated.Asanexample,MicrosoftisworkingwithNASA’sJetPropulsionLaboratory(JPL)todevelopschedulingsolutionsusingquantum-inspiredoptimizationalgorithmsonAzureQuantum,availableinthecloud.288AndGooglehascreatedaQuantumVirtualMachinethatanyonecanuseandthatisspecificallyintendedforresearchandeducation.289GiventherearemanynewandexcitingpotentialapplicationsforNext-generationcomputingtechnologieslikequantumcomputingarenotonlyadvancedandcomplexbutrequireskillsthatarehardtofindandinhighdemand.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier100#TechVisionTechnologyVision2023WhenAtomsmeetBitsAnotherserioussecurityissueforeverybusinessstemsfromquantumcomputing.Shor’salgorithmprovidesaquantum-theoreticalsolutiontoprimefactorization,whichcanbreakpublic-keyencryptionthatwerelyontoday.Quantumcomputerssimplyaren’tadvancedenoughyettodoso,butthey’regettingthereatabreakneckpace.292Whilesomebelievequantumcomputerswillbreakencryptioninthenext10to20years,therealityisthatsmaller,moretargetedattackswillhappensoon,andcompanieswillneedtohaveplanstoaddressthisinthenexttwoyears.Already,thereareseriousconcernsthathackersarecollectingdatanowtodecryptlateroncequantumcomputingisready,alsoreferredtoas“storenow,decryptlater”schemes.Currently,NISThasidentifiedsomequantum-resistantalgorithms,butpredictionsontheirviablelifecyclevary.Whatweknowisthatthesealgorithmswillnotlast20yearsandwehavetobeagilewithcryptographicmethods,readytoupgradeatanytime.Inthemeantime,companiesshouldpreparetotransitiontopost-quantumcryptographyandpotentiallyinvestincountermeasurestoreducetheimmediatethreatfrom“storenow,decryptlater”threats.Oneofthesecountermeasuresistoprotectthedistributionofkeys,andhere,quantumcomputingbecomesoursecurityally.Forexample,inearly2022,researchersfromJPMorganChase,Toshiba,andCienademonstratedthefullviabilityofaQuantumKeyDistribution(QKD)network,supporting800Gbpsdatarates—showingthatunderreal-worldenvironmentalconditions,thisnetworkcouldenablesecurecommunicationsandsuccessfullydefendagainstquantumcomputing-basedattacks.293Asthepositivefeedbackloopbetweenscienceandtechnologyaccelerates,understandingboththerisksandtheopportunitiesaheadiscritical.Companiesaregoingtowanttogetinvolvedinthiscompressedinnovation,andsoon.There’snolongertimetositbackandwait,thebigbangofcomputingandscienceishappeningnow.Companiesaregoingtowanttogetinvolvedinthiscompressedinnovation,andsoon.There’snolongertimetositbackandwait,thebigbangofcomputingandscienceishappeningnow.#TechVisionTechnologyVision2023WhenAtomsmeetBits#TechVisionTechnologyVision2023WhenAtomsmeetBitsThebottomlineSciencetechneedstobeoneveryone’sradar.Advancesinnext-generationcomputing,spacetechnologies,andbiotechwilldriveprogressinmaterialsandenergyinnovation,scienceinspaceforEarth,andsyntheticbiologyinanincrediblyexcitingtimeforpeople,businesses,andtheworld.Indeed,aschallengeslikepandemicsandclimatechangeareevermorepresent,it’stimetoinvestinandfullyunleashthepromiseofcompressedinnovationandacceleratedscienceandtechnologycycles,astheyevolveandrevolveovertime,drivingeachotherforwardintothefuture.101IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier#TechVisionTechnologyVision2023WhenAtomsmeetBits102AbouttheTechnologyVisionAbouttheTechnologyVisionFormorethan20years,AccenturehasdevelopedtheTechnologyVisionreportasasystematicreviewacrosstheenterpriselandscapetoidentifyemergingtechnologytrendsthatwillhavethegreatestimpactoncompanies,governmentagencies,andotherorganizationsinthecomingyears.Thisyearthetrendslookadecadeintothefuture,whileremainingrelevantacrossindustriesandactionableforbusinessestoday.TechnologyVision2023103#TechVisionTechnologyVision2023WhenAtomsmeetBitsTechnologyVision2023Editorial&ResearchTeamAccentureResearchReneeByrnesPrashantShuklaGerryFarkovaDonovanGriggsAmmarMohammedAbiraSathiyanathanVincenzoPalermoTalRodedMariuszBidelskiLauraConversoSelenKaraca-GriffinMichaelBiltzAriBernsteinJulianDreimanMariaFabbroniNaomiNishiharaKristaSchnellDavidStrachan-OlsonAbouttheTechnologyVisionAccentureLabsandAccentureResearchcollaborateontheannualresearchprocess,whichthisyearincluded:•InputfromtheTechnologyVisionExternalAdvisoryBoard,agroupofmorethantwodozenexperiencedindividualsfromthepublicandprivatesectors,academia,venturecapital,andentrepreneurialcompanies.Inaddition,theTechnologyVisionteamconductsinterviewswithtechnologyluminariesandindustryexperts,aswellasmanyAccenturebusinessleadersfromacrosstheorganization.•Accentureconductedasurveyof4,777C-levelexecutivesanddirectorsacross25industriestounderstandtheirperspectivesanduseofemergingtechnologiesacrosstheirorganizations.ThesurveyswerefieldedfromDecember2022throughJanuary2023across34countries.•Experientialresearchanddatasciencetoanalyzetechnologydevelopmentsandadvancements.Asashortlistofthemesemergesfromtheresearchprocess,theTechnologyVisionteamworkstovalidateandrefinethesetoftrends.Thethemesareweighedfortheirrelevancetoreal-worldbusinesschallenges.TheTechnologyVisionteamseeksideasthattranscendthewell-knowndriversoftechnologicalchange,concentratinginsteadonthethemesthatwillsoonstarttoappearontheC-levelagendasofmostenterprises.IntroductionDigitalidentityYourdata,mydata,ourdataGeneralizingAIOurforeverfrontier#TechVisionTechnologyVision2023WhenAtomsmeetBits#TechVisionTechnologyVision2023WhenAtomsmeetBitsSurveydemographicsArgentina3%Australia4%Austria2%Belgium2%Brazil4%Canada5%Chile2%China5%Colombia2%Denmark2%Finland2%France3%Germany4%India4%Indonesia2%Ireland2%Italy4%Japan4%Malaysia2%Mexico2%Netherlands2%Norway2%Poland2%Portugal2%SaudiArabia2%Singapore2%SouthAfrica3%Spain4%Sweden2%Switzerland2%Thailand2%UnitedArabEmirates2%UnitedKingdom4%UnitedStates16%CountriesSurveydemographics104105#TechVisionTechnologyVision2023WhenAtomsmeetBitsHighTech4%HigherEducation(US)4%IndustrialGoodsandEquipment6%Insurance6%MediaandEntertainment2%MedTech1%NaturalResources4%PublicService6%Retail6%SoftwareandPlatforms4%Travel3%Utilities4%IndustriesAerospaceandDefense1%Automotive5%Banking6%Biopharma1%CapitalMarkets3%CentralGovernment(CA)1%Chemicals5%Communications4%ConsumerGoodsandServices6%Energy4%FederalGovernment(US)4%HealthcarePayor(US)2%HealthProvider6%Revenue(USD)$50billionormore2%$20to$49.9billion6%$10to$19.9billion14%$5to$9.9billion27%$1to$4.9billion50%RolesChiefDigitalOfficer1%ChiefExecutiveOfficer5%ChiefFinanceOfficer10%ChiefHumanResourcesOfficer12%ChiefInformationOfficer5%ChiefInformationSecurityOfficer8%ChiefInnovationOfficer2%ChiefMarketingOfficer13%ChiefOperatingOfficer9%ChiefPurchasingOfficer1%ChiefRiskOfficer2%ChiefSecurityOfficer4%ChiefStrategyOfficer4%ChiefSupplyChainOfficer2%ChiefSustainabilityOfficer2%ChiefTechnologyOfficer4%ChiefTransformationOfficer1%DirectorofBusinessFunction6%DirectorofTechnology8%27%14%6%2%50%Surveydemographics106#TechVisionTechnologyVision2023WhenAtomsmeetBitsExecutivesummary1.Neurotwin.(n.d.):https://www.neurotwin.eu/2.Consoritum.(n.d.)Neurotwin:https://www.neurotwin.eu/consortium3.Browne,G.(2022,February15).TheQuesttoMakeaDigitalReplicaofYourBrain.Wired:https://www.wired.com/story/the-quest-to-make-a-digital-replica-of-your-brain/4.Anheuser-Busch&EverGrainCelebrateOpeningOfTheFirstMajorSiteOfU.S.Operations.(2022,June30).Anheuser-Busch:https://www.anheuser-busch.com/newsroom/2022/06/evergrain-opening/5.Shoup,M.E.(2022,July7).Anheuser-Busch&EverGrainCelebrateOpeningOfTheFirstMajorSiteOfU.S.Operations.FoodNavigator-USA:https://www.foodnavigator-usa.com/Article/2022/07/07/EverGrain-starts-commercial-production-of-upcycled-barley-protein6.MeettheAirshipBarleyMilkLatte–thedelicious,nutritiouscold-brewcoffeethatalmostwasn’t.(2022,March18).Evergrain:https://evergrainingredients.com/news/meet-the-airship-barley-milk-latte-the-delicious-nutritious-cold-brew-coffee-that-almost-wasnt/7.Best,D.(2021,April27).PostHoldingsinsnackstie-upwithA-BInBev-backedEverGrain.JustFood:https://www.just-food.com/news/post-holdings-in-snacks-tie-up-with-a-b-inbev-backed-evergrain/8.Arthur,R.(2021,March18).CoronaLaunchesSix-packBeerPackagingMadefromBarleyStraw.BeverageDailyhttps://www.beveragedaily.com/Article/2021/03/18/Corona-launches-beer-six-packs-made-from-barley-straw#9.Forristal,L.(2022,August18).StreamingviewershipsurpassedcableTVforthefirsttime,saysNielsen.TechCrunch:https://techcrunch.com/2022/08/18/streaming-viewership-surpassed-cable-tv-for-the-first-time-says-nielsen/10.Gill,V.(2022,October14).E-waste:FivebillionPhonestoBeThrownAwayin2022.BBC:https://www.bbc.com/news/science-environment-6324515011.Lavi,H.(2022,April21).MeasuringGreenhouseGasEmissionsinDataCentres:TheEnvironmentalImpactofCloudComputing.Climatiq:https://www.climatiq.io/blog/measure-greenhouse-gas-emissions-carbon-data-centres-cloud-computing12.Walker,A.(2021,July16).World’sFirst3D-printedSteelSmartBridgeOpensinAmsterdam.InfrastructureIntelligence:http://www.infrastructure-intelligence.com/article/jul-2021/world%E2%80%99s-first-3d-printed-steel-smart-bridge-opens-amsterdam13.Hall,C.(2022,May6).WhatisGoogleMapsARNavigationandLiveViewandHowDoYouUseIt?Pocket-lint:https://www.pocket-lint.com/apps/news/google/147956-what-is-google-maps-ar-navigation-and-how-do-you-use-it14.Hutchinson,A.(2022,November2).SnapchatAnnouncesNewVirtualTry-OnARPartnershipwithAmazon.SocialMediaToday:https://www.socialmediatoday.com/news/Snapchat-partners-with-Amazon-on-new-AR-Try-On-initiative/635643/15.McDowell,M.(2022,April28).WhySnapchatisGivingAwayitsARTry-onShoppingTools.VogueBusiness:https://www.voguebusiness.com/technology/why-snapchat-is-giving-away-its-ar-try-on-shopping-tools16.IntroducingWhisper.(2022,September21)OpenAI:https://openai.com/blog/whisper/17.CollaborativeRobotsMarketSize,Share&COVID-19ImpactAnalysis,ByPayloadCapavity,ByApplication,ByIndustry,andRegionalForecast,2021-2028.(2022,January).FortuneBusinessInsights:https://www.fortunebusinessinsights.com/industry-reports/collaborative-robots-market-10169218.MoxiCaseStudy,ShannonHealth.(n.d.)DilligentRobotics:https://static1.squarespace.com/static/606f1bb0f7e05e3329035ff8/t/636adf13f00ad670c037d49d/1667948329711/ANCC+Magnet+Case+Study+-+Shannon.pdf19.Walsh,B.(2022,August3).Finally,ananswertothequestion:AI—WhatisitGoodFor?Vox:https://www.vox.com/future-perfect/2022/8/3/23288843/deepmind-alphafold-artificial-intelligence-biology-drugs-medicine-demis-hassabis20.Lewis,T.(2022,October31).OneoftheBiggestProblemsinBiologyHasFinallyBeenSolved.ScientificAmerican:https://www.scientificamerican.com/article/one-of-the-biggest-problems-in-biology-has-finally-been-solved/21.AlphaFoldRevealstheStructureoftheProteinUniverse.(2022,July28).DeepMind:https://www.deepmind.com/blog/alphafold-reveals-the-structure-of-the-protein-universe22.Wenzl,T.(2022,July2).ComputationalChemistryResearchersCompleteMillenniaofResearchinFourYears.UniversityofNewMexico:https://news.unm.edu/news/releases-2022063023.Kolodny,L.(2021,September10).SolugenRaises$357MilliontoMakeChemicalsfromSugar,NotPetroleum.CNBC:https://www.cnbc.com/2021/09/09/solugen-raises-357-million-to-make-chemicals-and-plastic-from-plants.html24.NokiaRadioTechnologytoEnableASTSpaceMobile’sDirect-to-cellPhoneConnectivityFromSpace(2022,July28).BusinessWire:https://www.businesswire.com/news/home/20220728005646/en/Nokia-Radio-Technology-to-Enable-AST-SpaceMobile%E2%80%99s-Direct-to-cell-Phone-Connectivity-From-Space25.Williams,V.(2022,April7).HowRestaurantsAreManagingSupplyChainShortagesandInflation.DoorDash:https://get.doordash.com/en-us/blog/supply-chain-shortages26.Maze,J.(2022,May11).ALookIntotheImpactoftheDriverShortageonDistributors.RestaurantBusiness:https://www.restaurantbusinessonline.com/financing/look-impact-driver-shortage-distributors27.GlobalSupplyChains:AnEcosystemUnderThreat.(n.d.)TrendMicro:https://www.trendmicro.com/explore/glrans/01589-tm1-en-ifg#page=128.Chinesefactoriescloseasdroughthitshydropower(2022,August17).AlJazeera:https://www.aljazeera.com/economy/2022/8/17/chinese-factories-close-as-drought-hits-hydropower29.Acceleratingglobalcompaniestowardnetzeroby2050.(2022)Accenture:https://www.accenture.com/content/dam/accenture/final/capabilities/strategy-and-consulting/strategy/document/Accenture-Net-Zero-By-2050-Global-Report-2022.pdfReferencesReferences107#TechVisionTechnologyVision2023WhenAtomsmeetBits30.Fernandez,S.(2022,October5).FantasticBioplastic.UCSantaBarbara:https://www.news.ucsb.edu/2022/020733/fantastic-bioplastic31.BioplasticsMadeofBacteriaCanReducePlasticWasteinOceans.(2022,October6).UniversityofRochester:https://www.rochester.edu/newscenter/bioplastics-reduce-plastic-waste-in-oceans-536322/32.Dayan,I.,Roth,H.R.,etal.(2021,September15).FederatedlearningforpredictingclinicaloutcomesinpatientswithCOVID-19.NatureMedicine:https://www.nature.com/articles/s41591-021-01506-3Digitalidentity33.CaseStudy#2:OfferingTwo-FactorAuthentication.(n.d.)NewAmerica:https://www.newamerica.org/in-depth/getting-internet-companies-do-right-thing/case-study-2-offering-two-factor-authentication/34.HistoryofIrisRecognition.(n.d.)UniversityofCambridge:https://www.cl.cam.ac.uk/~jgd1000/history.html35.Gallagher,S.(2017,December29).HowHotmailChangedMicrosoftandEmailForever.ArsTechnica:https://arstechnica.com/information-technology/2017/12/how-hotmail-changed-microsoft-and-email-forever/36.VandePoll,M.(2020,February17).TheHistoryofDigitalIdentityinEstonia.Cybernetica:https://cyber.ee/resources/news/the-history-of-digital-identity-in-estonia/37.FacebookExpandsitsSocialPlatformacrosstheWebThroughGeneralAvailabilityofFacebookConnect.(2008,December4).Meta:https://about.fb.com/news/2008/12/facebook-expands-its-social-platform-across-the-web-through-general-availability-of-facebook-connect/38.Kobie,N.(2019,June7).TheComplicatedTruthAboutChina’sSocialCreditSystem.Wired:https://www.wired.co.uk/article/china-social-credit-system-explained39.Strachan,M.(2022,July14).MetaMaskCo-Founders:‘WeCan’tStopPeopleFromMakingPonzisonBlockchains’Vice:https://www.vice.com/en/article/v7vea9/metamask-co-founders-we-cant-stop-people-from-making-ponzis-on-blockchains40.Aadhaarenrollmentcrosses1billionmark:RaviShankarPrasad(2016,April4).BusinessStandard:https://www.business-standard.com/article/current-affairs/aadhaar-enrollment-crosses-1-billion-mark-ravi-shankar-prasad-116040400863_1.html41.AadhaarIDsavingIndiangovtabout$1billionperannum:WorldBank(2016,January14).EconomicTimes:https://economictimes.indiatimes.com/news/economy/finance/aadhaar-id-saving-indian-govt-about-1-billion-per-annum-world-bank/articleshow/50575112.cms?from=mdr42.TheHistoryoftheGeneralDataProtectionRegulation(n.d.)EuropeanDataProtectionSupervisor:https://edps.europa.eu/data-protection/data-protection/legislation/history-general-data-protection-regulation_en43.Steele,K.(2018,November29).DeltaunveilsfirstbiometricterminalinU.S.inAtlanta;nextstop:Detroit.DeltaAirLines:https://news.delta.com/delta-unveils-first-biometric-terminal-us-atlanta-next-stop-detroit44.Appleannouncesfirststatessigneduptoadoptdriver’slicensesandstateIDsinAppleWallet(2021,September1).Apple:https://www.apple.com/newsroom/2021/09/apple-announces-first-states-to-adopt-drivers-licenses-and-state-ids-in-wallet/45.Tait,D.(2022,July1).MicrosoftGoingBigonIdentitywiththeLaunchofEntra.DarkReading:https://www.darkreading.com/omdia/microsoft-going-gig-on-identity-with-the-launch-of-entra46.Alspach,K.(2022,May31).MicrosoftWantsEverythingtoComeWithitsVerifiedCheckMark.Protocol:https://www.protocol.com/bulletins/microsoft-verified-id-digital-privacy47.MicrosoftEntraVerifiedID.(n.d.)https://www.microsoft.com/en-us/security/business/identity-access/microsoft-entra-verified-id48.EarlyWarningServices,BigBanksLaunchIDServiceAuthentify(2022,April5).PYMNTS:https://www.pymnts.com/identity/2022/early-warning-services-big-banks-launch-id-service-authentify/49.Peterson,M.(2022,May25).DigitalIDfeatureinAppleWallethasexpandedtoMaryland.AppleInsider:https://appleinsider.com/articles/22/05/25/digital-id-feature-in-apple-wallet-has-expanded-to-maryland50.Burt,C.(2022,September27).GatesFoundationcommits$200MtodigitalIDandotherpublicinfrastructure.BiometricUpdate:https://www.biometricupdate.com/202209/gates-foundation-commits-200m-to-digital-id-and-other-public-infrastructure51.DigitalIdentitySolutionsMarketbyOffering(SolutionsandServices),SolutionType(IdentityVerification,Authentication),IdentityType(BiometricandNon-Biometric),DeploymentMode,OrganizationSize,VerticalandRegion-GlobalForecastto2027.(2022,September).ResearchandMarkets:https://www.researchandmarkets.com/reports/5393866/digital-identity-solutions-market-by-offering52.b.wellOverview.(n.d.)Pitchbook:https://pitchbook.com/profiles/company/121691-08#overview53.Landi,H.(2021,April2).MastercardMakesHealthcareMovewithDigitalIDSolutionPatientsCanUseontheirSmartphones.FierceHealthcare:https://www.fiercehealthcare.com/tech/mastercard-makes-healthcare-move-digital-id-solution-patients-can-use-their-smartphones54.HowThedaCarepowerspopulationhealthwithb.well’sdigitalfrontendandMastercardIDVerificationservice.(n.d.)Mastercard:https://www.mastercard.us/en-us/business/large-enterprise/healthcare-solutions/security-solutions/bwell-thedacare-case-study.html55.Sonnenenergiefüralle:WienEnergieStartetNeuesBürgerInnen-Solarkraftwerk.(2021,June6).WienEnergie:https://www.wienenergie.at/pressrelease/sonnenenergie-fuer-alle-wien-energie-startet-neues-buergerinnen-solarkraftwerk/56.SustainableDevelopmentGoals.(n.d)UN:https://unstats.un.org/sdgs/metadata/?Text=&Goal=16&Target=16.957.Kotkas,K.(2022,February25).FollowinginEstonia’sFootsteps:BlueprintsforaSuccessfulDigitalID.SecurityMagazine:https://www.securitymagazine.com/articles/97159-following-in-estonias-footsteps-blueprints-for-a-successful-digital-id58.AadhaarkeyIDlayerforIndia-firstinnovations:UIDAICEOSaurabhGarg.(2022,July8).EconomicTimes:https://economictimes.indiatimes.com/tech/technology/aadhaar-key-id-layer-for-india-first-innovations-uidai-ceo-saurabh-garg/articleshow/92732142.cmsReferences108#TechVisionTechnologyVision2023WhenAtomsmeetBits59.Weiss,E.(2022,July19).IndiaUnveilsNewFace-BasedAadhaarAuthenticationApp.FindBiometrics:https://findbiometrics.com/india-unveils-new-face-based-aadhaar-authentication-app-071901/60.AePSProductOverview.(n.d.)NationalPaymentsCorporationofIndia:https://www.npci.org.in/what-we-do/aeps/product-overview61.Saini,SandHussain,S.(2021,October1).LeveragingIndia’sAadhaarplatformtoeaseCOVID-19pain.EastAsiaForum:https://www.eastasiaforum.org/2021/10/01/leveraging-indias-aadhaar-platform-to-ease-covid-19-pain/62.Sharwood,S.(2022,February9).SriLankatoAdoptIndia’sAadhaarDigitalIdentityScheme.TheRegister:https://www.theregister.com/2022/02/09/sri_lanka_to_adopt_indias/63.Hurd,D.(2022,December12).A‘TrojanHorse’forTyranny:BrusselsRollingOutaNew‘DigitalIdentity’SystemforEUCitizens.CBNNews:https://www1.cbn.com/cbnnews/world/2022/may/is-the-eu-undergoing-a-chinafication-brussels-will-be-rolling-out-a-new-digital-identity-nbsp64.Tung,L.(2022,February9).FBIWarns:SIM-swappingAttacksAreRocketing,Don’tBragAboutYourCryptoOnline.ZDNET:https://www.zdnet.com/finance/blockchain/fbi-warns-sim-swapping-attacks-are-rocketing-dont-brag-about-your-crypto-online/65.ForgottenPasswordsareIncreasingYourWebsite’sAbandonmentRate.(2021,May6).iProov:https://www.iproov.com/blog/forgotten-passwords-increasing-websites-abandonment-rate66.TheImpactofInvalidTrafficonMarketing.(2022,May).Cheq:https://cheq.ai/wp-content/uploads/2022/05/The-Impact-of-Invalid-Traffic-on-Marketing-2.pdf67.DigitalAdFraudCostsWillRiseto$35BGloballyThisYear.(2020,October28).UniversityofBaltimore:http://www.ubalt.edu/news/news-releases.cfm?id=362168.MOSIP,Open-SourceNationalIDSystem,GainsMomentuminAfricaandAsia.(2020,December20).IdentityReview:https://identityreview.com/mosip-open-source-national-id-system-gains-momentum-in-africa-and-asia69.Burt,C.(2022,September6).MOSIP’sGrowthExaminedasAsianDigitalIdentitySchemesExpandinReach,Applications.BiometricUpdate:https://www.biometricupdate.com/202209/mosips-growth-examined-as-asian-digital-identity-schemes-expand-in-reach-applications70.Vescent,H.(2022,July5).DecentralizedIdentifiers1.0areNowaW3CStandard.BiometricUpdate:https://www.biometricupdate.com/202207/decentralized-identifiers-1-0-are-now-a-w3c-standard71.LinuxFoundationAnnouncesanIntenttoFormtheOpenWalletFoundation.(2022,September13).TheLinuxFoundation.https://www.linuxfoundation.org/press/linux-foundation-announces-an-intent-to-form-the-openwallet-foundation72.Harper,C.(2021,March5).Microsoft’sIONDigitalIDNetworkIsLiveonBitcoin.Coindesk:https://www.coindesk.com/markets/2021/03/25/microsofts-ion-digital-id-network-is-live-on-bitcoin/73.OverviewofWeb3Wallets.(n.d.)Alchemy.https://www.alchemy.com/web3-wallets-overview74.HyperledgerIdentityRound-up:ACrossSectionofProductionDigitalIdentitySolutionsBuiltUsingHyperledgerTechnologies.(2022,September28).Hyperledger:https://www.hyperledger.org/blog/2022/09/28/hyperledgeridentity-round-up-a-cross-section-of-production-digital-identity-solutions-built-using-hyperledger-technologies75.BCaimstocutgovernmentredtapewithHyperledgerIndy.(n.d.)Hyperledger:https://www.hyperledger.org/learn/publications/orgbook-case-study76.StarbucksBrewingRevolutionaryWeb3ExperienceforitsStarbucksRewardsMembers.(2022,September12).Starbucks:https://stories.starbucks.com/press/2022/starbucks-brewing-revolutionary-web3-experience-for-its-starbucks-rewards-members/77.Starbucks:We’recreatingthedigitalThirdPlace.(2022,May3).Starbucks:https://stories.starbucks.com/stories/2022/starbucks-creating-the-digital-third-place/78.Permission.iotoLaunchIndustry-FirstDemandSidePlatform(DSP)OfferingCryptoRewards.(2021,October11).Permission.io:https://www.prnewswire.com/news-releases/permissionio-to-launch-industry-first-demand-side-platform-dsp-offering-crypto-rewards-301396159.html79.Permission.io:Redeem.(n.d.):https://redeem.permission.io/?_ga=2.245706951.257697819.1666984884-1674603746.166684352680.SAP,UnileverPilotBlockchainTechnologySupportingDeforestation-freePalmOil.(2022,March21).Unilever:https://www.unilever.com/news/press-and-media/press-releases/2022/sap-unilever-pilot-blockchain-technology-supporting-deforestationfree-palm-oil/81.delCastillo,M.,Schifrin,M.,etal.(2022,February8).TheBlockchain502022.Forbers:https://www.forbes.com/sites/michaeldelcastillo/2022/02/08/forbes-blockchain-50-2022/?sh=526ecf2d31c682.Goldman’sInterestinNFTsCouldSpeedtheTokenizationofRealAssets.(2022,April28).PYMNTS:https://www.pymnts.com/nfts/2022/goldman-sachs-interest-could-speed-tokenization-real-assets-nfts/83.Gartenberg,C.(2021,April27).WhyApple’sNewPrivacyFeatureisSuchaBigDeal.TheVerge:https://www.theverge.com/2021/4/27/22405474/apple-app-tracking-transparency-ios-14-5-privacy-update-facebook-data84.Lukovitz,K.(2022,May5).PrivacyUpdate:ATTIDFAOpt-InRateAt25%Overall,ButVariesByVertical.MediaPost:https://www.mediapost.com/publications/article/373613/privacy-update-att-idfa-opt-in-rate-at-25-overal.html85.Burgess,M.(2022,January27).GoogleHasaNewPlantoKillCookies.PeopleAreStillMad.Wired:https://www.wired.com/story/google-floc-cookies-chrome-topics/86.Titone,T.(2022,January31).TopicsAPI-TheGoogleFLoCreplacementexplained.AdTechExplained:https://adtechexplained.com/google-topics-api-explained/87.Nguyen,G.(2022,January25).GoogleKillsFLoC,IntroducesTopicsAPIasitsNext-genTargetingTech.SearchEngineLand:https://searchengineland.com/google-kills-floc-introduces-topics-api-379120References109#TechVisionTechnologyVision2023WhenAtomsmeetBits88.GarnerResearchers.(2022,May31).GartnerIdentifiesTopFiveTrendsinPrivacyThrough2024.Gartner:https://www.gartner.com/en/newsroom/press-releases/2022-05-31-gartner-identifies-top-five-trends-in-privacy-through-202489.PreparingforaWorldWithoutThird-partyCookies.(2020,October).Epsilon:https://www.epsilon.com/hubfs/3PC_Deprecation_Research_Exec_Summary_23Oct2020.pdf?hsCtaTracking=6eda0e9d-6c8d-4c52-922f-1e396ac75978%7C8c887de0-50d4-40c9-9ebe-93d1c26e8d2990.Uzialko,A.(2023,January23).HowGDPRIsImpactingBusinessandWhattoExpectin2023.BusinessNewsDaily:https://www.businessnewsdaily.com/15510-gdpr-in-review-data-privacy.html91.GDPREnforcementTracker(n.d.):https://www.enforcementtracker.com/92.DigitalidentityinWeb3.(n.d.)J.P.Morgan:https://www.jpmorgan.com/onyx/content-hub/digital-identity-in-web3.htm93.Fadilpašić,S.(2022,October27).JPMorganExploringDigitalIdentityWalletsinWeb3.CryptoNewshttps://cryptonews.com/news/jpmorgan-exploring-digital-identity-wallets-web3.htmYourdata,mydata,ourdata94.Maldarelli,C.(2021,April26).Why10,000stepsadayisn’tthesecrettobetterhealth.PopularScience:https://www.popsci.com/story/health/10000-steps-evidence-study/95.KelleyBlueBookCelebrates80YearsofTrust.(n.d.).KelleyBlueBook:https://mediaroom.kbb.com/press-releases?item=10578496.Coleman,J.(2022,July22).LandsatLegacy:NASA-USGSProgramObservingEarthfromSpaceTurns50.NASA:https://www.nasa.gov/feature/goddard/2022/landsat-legacy-nasa-usgs-program-observing-earth-from-space-turns-5097.Canavan,H.(2014,August5).YelpTurns10:FromStartuptoOnlineReviewDominance.Eater.com:https://www.eater.com/2014/8/5/6177213/yelp-turns-10-from-startup-to-online-review-dominance98.Press,G.(2013,May9).AVeryShortHistoryOfBigData.Forbes:https://www.forbes.com/sites/gilpress/2013/05/09/a-very-short-history-of-big-data/?sh=1743b36665a199.Glassdoor.comlaunchespublicbeta,openingdoorstoemployeesalaries,bonuses,reviewsandratingsatanycompanyforfree.(2008,June11).Glassdoor:https://www.glassdoor.com/about-us/glassdoorcom-launches-public-beta-opening-doors-employee-salaries-bonuses-reviews-ratings-company-free/100.Armstrong,M.(2019,April16).GlobalDataCreationisAbouttoExplode.Statista:https://www.statista.com/chart/17727/global-data-creation-forecasts/101.OpenGovernment.(n.d.).Data.gov:https://data.gov/open-gov/102.Dehghani,Z.(2019,May20).HowtoMoveBeyondaMonolithicDataLaketoaDistributedDataMesh.MartinFowler.com:https://martinfowler.com/articles/data-monolith-to-mesh.html103.LaMonica,P.(2020,September17).Snowflakesharesmorethandouble.It’sthebiggestsoftwareIPOever.CNNBusiness:https://www.cnn.com/2020/09/16/investing/snowflake-ipo/index.html104.Taylor,P.(2022,September8).Amountofdatacreated,consumed,andstored2010-2020,withforecaststo2025.Statista:https://www.statista.com/statistics/871513/worldwide-data-created/105.Clark,S.(2022,July6).World’srocketsonpaceforrecordyearoflaunchactivity.SpaceflightNow:https://spaceflightnow.com/2022/07/06/worlds-rockets-on-pace-for-record-year-of-launch-activity/106.Morethan680financialinstitutionswithUS$130+trillioninassetscallonnearly10,400companiestodiscloseenvironmentaldatathroughCDP.(2022,March14).CDP:https://www.cdp.net/en/articles/media/More-than-680-financial-institutions-call-on-nearly-10400-companies-to-disclose-environmental-data-through-CDP107.BoardDiversityMatrixDisclosureRequirmentsandExamples.(2023,January26).Nasdaq:https://listingcenter.nasdaq.com/assets/BoardMatrixExamples_Website.pdf108.Canavan,H.YelpTurns10.109.Luca,M.(2016).Reviews,Reputation,andRevenue:TheCaseofYelp.com.HarvardBusinessSchool:https://www.hbs.edu/ris/Publication%20Files/12-016_a7e4a5a2-03f9-490d-b093-8f951238dba2.pdf110.Anderson,M.,andMagruder,J.(2013).DoesYelpAffectRestaurantDemand?AgriculturalandResourceEconomics:https://s.giannini.ucop.edu/uploads/giannini_public/9e/fe/9efe6100-005c-4b7c-aaa8-678a96a883cb/v16n5_1.pdf111.Infinitehorizons.(n.d.).Cirium.com:https://www.cirium.com/about/112.Cirium.(2019,May21).Cirium:ASmarterWaytoTravel.YouTube.com:https://www.youtube.com/watch?v=wtRZrJijNNM113.CiriumintegratesthemostaccurateCO2emissionsandflighttrackingdatawithitsunrivalledfleetsdatabase.(2022,October18).Cirium.com:https://www.cirium.com/thoughtcloud/cirium-integrates-most-accurate-co2-emissions-and-flight-tracking-data-with-fleets-database/114.ContainerRatesAlert:Calmbeforestorm,aslong-termoceanfreightratesholdsteadyaheadofexpectedNewYearpain.(2022,December22).Xeneta.com:https://www.xeneta.com/news/calm-before-storm-as-long-term-ocean-freight-rates-hold-steady-ahead-of-expected-new-year-pain115.ABFUsesXenetatoNegotiatea30%DecreaseinOceanRatesandProvideCategoryLeadershipinLogisticsProcurement.(n.d.).Xeneta.com:https://www.xeneta.com/abf-customer-case-study116.Consumerdemandforfoodtransparencyremainsstrongasomnichannelrises.(2022,January25).NielsenIQ:https://nielseniq.com/global/en/news-center/2022/consumer-demand-for-food-transparency-remains-strong-as-omnichannel-rises/117.Adams,H.(2021,December13).Reportshowsshopperswanttransparencyinthesupplychain.SupplyChain:https://supplychaindigital.com/sustainability/report-shows-shoppers-want-transparency-supply-chain118.Armstrong,M.GlobalDataCreationisAbouttoExplode.119.Taylor,P.Amountofdatacreated,consumed,andstored.120.Hasan,M.(2022,May18).StateofIoT2022:NumberofconnectedIoTdevicesgrowing18%to14.4billionglobally.IoTAnalytics:https://iot-analytics.com/number-connected-iot-devices/References110#TechVisionTechnologyVision2023WhenAtomsmeetBits121.Buonfantino,G.(2022,April27).Newresearchshowsconsumersmoreinterestedinbrands’valuesthanever.GoogleCloudBlog:https://cloud.google.com/blog/topics/consumer-packaged-goods/data-shows-shoppers-prioritizing-sustainability-and-values122.TrustHasToBeEarned.(n.d.).IceBug:https://www.icebugitalia.it/en/segui-le-impronte123.McGee,B.(2022,May25).Icebugpromotessustainabilelifestyleasannualsales,profitsrise.OutdoorIndustryCompass:https://www.oicompass.com/financial-results/icebug-promotes-sustainable-lifestyle-as-annual-sales-profits-rise/96541.article124.Tameez,H.(2022,November30).TheWashingtonPostlaunchesayearinnewsalaSpotifyWrapped.NiemanLab:https://www.niemanlab.org/2022/11/the-washington-post-launches-a-year-in-news-a-la-spotify-wrapped/125.Perez,S.(2013,January8).TargetNowPriceMatchingAmazon,Walmart.com,BestBuy.com&Toysrus.comYear-Round.TechCrunch:https://techcrunch.com/2013/01/08/target-now-price-matching-amazon-walmart-com-bestbuy-com-toyrus-com-year-round/126.Kemp,S.(2022,October20).Digital2022:OctoberGlobalStatshotReport.Datareportal.com:https://datareportal.com/reports/digital-2022-october-global-statshot127.What’snewinAppleWatchandwatchOS9.(n.d.).AppleWatchUserGuide:https://support.apple.com/guide/watch/whats-new-apdb93ea3872/watchos128.Nano-sensordetectspesticidesonfruitinminutes.(2022,June7).ScienceDaily:https://www.sciencedaily.com/releases/2022/06/220607121014.htm129.Bild,N.(2022,July26).Don’tBeaDrip:ATinyML-BasedSolutionforAcousticPipeLeakDetecton.EdgeImpulse:https://www.edgeimpulse.com/blog/dont-be-a-drip-a-tinyml-based-solution-for-acoustic-pipe-leak-detection130.McQuate,S.(2022,March16).Tinybattery-freedevicesfloatinthewindlikedandelionseeds.UWNews:https://www.washington.edu/news/2022/03/16/battery-free-devices-float-in-wind-like-dandelion-seeds/131.ClimateTrace:IndependentGreenhouseGasEmissionsTracking.(n.d.).ClimateTrace.org:https://www.climatetrace.org/about132.WorldView-3SatelliteSensor(30cm).(n.d.).SatelliteImagingCorporation:https://www.satimagingcorp.com/satellite-sensors/worldview-3/133.Real-TimeSatelliteMonitoringwithPlanet.(n.d.).Planet.com:https://www.planet.com/products/monitoring/134.Ziliani,M.,Altaf,M.,etal.(2022,February15).Earlyseasonpredictionofwithin-fieldcropyieldvariabilitybyassimilatingCubeSatdataintoacropmodel.ScienceDirect:https://www.sciencedirect.com/science/article/pii/S0168192321004226?via%3Dihub135.Ferreira,T.(2022,August8).PlanetDataHelpsAdvanceThePromiseOfDigitalAgricultureAndEnablesNovelWaterDynamicsResearch.Planet.com:https://www.planet.com/pulse/planet-data-helps-advance-the-promise-of-digital-agriculture-and-enables-novel-water-dynamics-research/136.Wooden,A.(2022,September21).T-Mobileisprovidingthe5GgoodstoanewAIwildfiredetectionsystem.Telecoms.com:https://telecoms.com/517551/t-mobile-is-providing-the-5g-goods-to-a-new-ai-wildfire-detection-system/137.T-MobileTakesCoverageAboveandBeyondWithSpaceX.(2022,August25).T-Mobile.com:https://www.t-mobile.com/news/un-carrier/t-mobile-takes-coverage-above-and-beyond-with-spacex138.AcommissionedstudyconductedbyForresterConsultingonbehalfofAmperity.(2022,June).EvolveYourDataPracticesToStayAheadOfTheCompetition.Forrester:https://assets.ctfassets.net/5vqt5w81x2im/1HOANJ4cyvHPd1w5WRSf5f/b95f310d796029d7619789c5a2b28dab/Data_Practices_Opportunity_Snapshot-Forrester.pdf139.Cole,A.(2021,November24).AIwillsoonoverseeitsowndatamanagement.VentureBeat:https://venturebeat.com/ai/ai-will-soon-oversee-its-own-data-management/140.BuildaScalableContentModerationStrategyusingAIAutomation.(n.d.).Clarifai.com:https://www.clarifai.com/customers/opentable141.CaseStudy:NASA.(n.d.).Stardog.com:https://www.stardog.com/company/customers/nasa/142.DataCultureisateamsportfortheSeattleSeahawks–andtheirfanswineverytime.(n.d.).Tableau.com:https://www.tableau.com/solutions/customer/data-culture-team-sport-seattle-seahawks-and-their-fans-win-every-time143.TheStateofDataScience2020:Movingfromhypetowardmaturity.(2020).Anaconda:https://www.anaconda.com/state-of-data-science-2020144.Sallam,R.,Friedman,T.,etal.(2022,March11).TopTrendsinDataandAnalytics,2022.Gartner:https://www.gartner.com/document/4012385?ref=solrAll&refval=351999153145.Dehghani,Z.HowtoMoveBeyondaMonolithicDataLake.146.BentleySystemsLaunchesiTwinExperience,iTwinCapture,andiTwinIoTtoExtendiTwinPlatform.(2022,November15).Bentley:AdvancingInfrastructure:https://www.bentley.com/wp-content/uploads/bsy-11152022-itwin-experience-itwin-capture-itwin-iot-launch.pdf147.Bock,E.(2023,January).ComplianceMonitoringMethodology.Measurabl.com:https://support.measurabl.com/hc/en-us/articles/4831627362701-Compliance-Monitoring-Methodology148.ProductSpotlight:ComplianceMonitoring.(2022,March17).Measurabl.com:https://www.measurabl.com/resources/product-spotlight-compliance-monitoring/149.Fried,I.(2022,December21).AxiosLogin.Axios.com:https://www.axios.com/newsletters/axios-login-5f2df8f4-b28d-45a4-abf8-e89815ec4b35.html150.Tameez,H.TheWashingtonPostlaunchesayearinnews.151.2022YearinSport.(2022).Strava.com:https://www.strava.com/yis-community-2022152.Weworkaroundtheclocktosafeguardourplatformandcombatfakereviews.(n.d.).Trustpilot.com:https://www.trustpilot.com/trust/combating-fake-reviews153.Reviewsintherightplaceattherighttime.(n.d.).Trustpilot.com:https://business.trustpilot.com/features/trustbox-widgets154.Alamalhodaei,A.(2021,October12).SteveWozniakandAlexFielding’sstartupPrivateeraimstobetheGoogleMapsofspace.TechCrunch:https://techcrunch.com/2021/10/12/steve-wozniak-privateer-space-company/References111#TechVisionTechnologyVision2023WhenAtomsmeetBitsGeneralizingAI155.Veisdal,J.(2019,September12).TheBirthplaceofAI.Cantor’sParadise:https://www.cantorsparadise.com/the-birthplace-of-ai-9ab7d4e5fb00156.GeoffreyHinton:alookattheprolificcareerofAIanddeeplearningpioneerbehindbackpropagation,unsupervisedlearning.(2022,May19).Ai.nl:https://www.ai.nl/artificial-intelligence/geoffrey-hinton-a-look-at-the-prolific-career-of-ai-and-deep-learning-pioneer-behind-backpropagation-unsupervised-learning/157.Krizhevsky,A.,Sutskever,I.,etal.(2012).ImageNetClassificationwithDeepConvolutionalNeuralNetworks.NIPS2012:https://papers.nips.cc/paper/2012/hash/c399862d3b9d6b76c8436e924a68c45b-Abstract.html158.Olanoff,D.(2015,December11).ArtificialIntelligenceNonprofitOpenAILaunchesWithBackingFromElonMuskandSamAltman.TechCrunch:https://techcrunch.com/2015/12/11/non-profit-openai-launches-with-backing-from-elon-musk-and-sam-altman/159.AlphaGo:TheChallengeMatch.(n.d.).Deepmind.com:https://www.deepmind.com/research/highlighted-research/alphago/the-challenge-match160.Vaswani,A.,Shazeer,N.,etal.(2017,June12).AttentionIsAllYouNeed.arXiv:https://arxiv.org/abs/1706.03762161.Johnson,K.(2019,September26).HuggingFacelaunchespopularTransformersNLPlibraryforTensorFlow.VentureBeat:https://venturebeat.com/business/hugging-face-launches-popular-transformers-nlp-library-for-tensorflow/162.TheArtificialIntelligenceAct.(n.d.):https://artificialintelligenceact.eu/163.Brown,T.,Mann,B.,etal.(2020,May28).LanguageModelsareFew-ShotLearners.arXiv:https://arxiv.org/abs/2005.14165164.OntheOpportunitiesandRisksofFoundationModels.(2021,August16).StanfordUniversity:https://fsi.stanford.edu/publication/opportunities-and-risks-foundation-models165.Zhavoronkov,A.(2021,July19).WuDao2.0–Bigger,Stronger,FasterAIfromChina.Forbes:https://www.forbes.com/sites/alexzhavoronkov/2021/07/19/wu-dao-20bigger-stronger-faster-ai-from-china/?sh=35dcf4e26fb2166.Gault,M.(2022,August31).AnAI-GeneratedArtworkWonFirstPlaceataStateFairFineArtsCompetition,andArtistsArePissed.Vice:https://www.vice.com/en/article/bvmvqm/an-ai-generated-artwork-won-first-place-at-a-state-fair-fine-arts-competition-and-artists-are-pissed167.AGeneralistAgent.(2022,November10).Deepmind.com:https://www.deepmind.com/publications/a-generalist-agent168.ChatGPT:OptimizingLanguageModelsforDialogue.(2022,November30).OpenAI:https://openai.com/blog/chatgpt/169.Roose,K.(2022,December5).TheBrillianceandWeirdnessofChatGPT.TheNewYorkTimes:https://www.nytimes.com/2022/12/05/technology/chatgpt-ai-twitter.html170.Kreitman,A.(2022,December13).WhyMyWritingCareerIsJustAboutOver.TheMarketingAdvocate:https://medium.com/the-marketing-advocate/why-my-writing-career-is-just-about-over-deece661eaa2171.GPT-4isOpenAI’smostadvancedsystem,producingsaferandmoreusefulresponses.(n.d.).OpenAI:https://openai.com/product/gpt-4172.Wiggers,K.(2023,March14).OpenAIreleasesGPT-4,amultimodalAIthatitclaimsisstate-of-the-art.TechCrunch:https://techcrunch.com/2023/03/14/openai-releases-gpt-4-ai-that-it-claims-is-state-of-the-art/173.Vaswani,A.,Shazeer,N.,etal.AttentionIsAllYouNeed.174.Ho,V.(2022,May24).Build:AzureOpenAIServicehelpscustomersaccelerateinnovationwithlargeAImodels;Microsoftexpandsavailability.Microsoft:https://blogs.microsoft.com/ai/azure-openai-service-helps-customers-accelerate-innovation-with-large-ai-models-microsoft-expands-availability/175.Dai,A.,andDu,N.(2021,December9).MoreEfficientIn-ContextLearningwithGLaM.GoogleResearch:https://ai.googleblog.com/2021/12/more-efficient-in-context-learning-with.html176.Alvi,A.,andKharya,P.(2021,October11).UsingDeepSpeedandMegatrontoTrainMegatron-TuringNLG530B,theWorld’sLargestandMostPowerfulGenerativeLanguageModel.MicrosoftResearchBlog:https://www.microsoft.com/en-us/research/blog/using-deepspeed-and-megatron-to-train-megatron-turing-nlg-530b-the-worlds-largest-and-most-powerful-generative-language-model/177.Alford,A.(2022,June7).MetaOpen-Sources175BillionParameterAILanguageModelOPT.InfoQ:https://www.infoq.com/news/2022/06/meta-opt-175b/178.IntroducingPCL-BAIDUWenxin(ERNIE3.0Titan),theWorld’sFirstKnowledgeEnhancedMulti-Hundred-BillionModel.(2021,December28).BaiduResearch:http://research.baidu.com/Blog/index-view?id=165179.Liang,J.(2022,May1).FoundationModelsandtheFutureofMulti-ModalAI.LastWeekinAI:https://lastweekin.ai/p/multi-modal-ai180.OntheOpportunitiesandRisksofFoundationModels.181.AGeneralistAgent.182.Heikkilä,M.(2022,May23).ThehypearoundDeepMind’snewAImodelmisseswhat’sactuallycoolaboutit.MITTechnologyReview:https://www.technologyreview.com/2022/05/23/1052627/deepmind-gato-ai-model-hype/183.Merritt,R.(2022,March25).WhatisaTransformerModel?NVIDIA:https://blogs.nvidia.com/blog/2022/03/25/what-is-a-transformer-model/184.Huge“foundationmodels”areturbo-chargingAIprogress.(2022,June11).TheEconomist:https://www.economist.com/interactive/briefing/2022/06/11/huge-foundation-models-are-turbo-charging-ai-progress185.Heaven,W.(2021,December21).2021wastheyearofmonsterAImodels.MITTechnologyReview:https://www.technologyreview.com/2021/12/21/1042835/2021-was-the-year-of-monster-ai-models/186.Alayrac,J.,Donahue,J.etal.(2022,April29).Flamingo:aVisualLanguageModelforFew-ShotLearning.arXiv:https://arxiv.org/abs/2204.14198187.Announcingthe2022AIIndexReport.(2022).StanfordUniversityHuman-CenteredArtificialIntelligence:https://hai.stanford.edu/research/ai-index-2022References112#TechVisionTechnologyVision2023WhenAtomsmeetBits188.ThestateofgenerativeAIin7charts.(2023,January25).CBInsights:https://www.cbinsights.com/research/generative-ai-funding-top-startups-investors/189.MicrosoftandOpenAIextendpartnership.(2023,January23).MicrosoftCorporateBlogs:https://blogs.microsoft.com/blog/2023/01/23/microsoftandopenaiextendpartnership/190.Daws,R.(2022,November2).Meta’sprotein-foldingAIremindsusit’snotjustametaversefirm.AINews:https://www.artificialintelligence-news.com/2022/11/02/meta-protein-folding-ai-not-just-metaverse-firm/191.IITM&UTAustin’sGeneralizableNeRFTransformerDemonstratesTransformers’CapabilitiesforGraphicalRendering.(2022,August3).Synced:https://syncedreview.com/2022/08/03/iitm-ut-austins-generalizable-nerf-transformer-demonstrates-transformers-capabilities-for-graphical-rendering/192.T,M.,Wang,P.,etal.(2022).IsAttentionAllNeRFNeeds?arXiv:https://vita-group.github.io/GNT/193.Yuan,L.,Chen,D.,etal.(2021,November).Florence:ANewFoundationModelforComputerVision.Microsoft:https://www.microsoft.com/en-us/research/publication/florence-a-new-foundation-model-for-computer-vision/194.Sevilla,J.,Heim,L.,etal.(2022,March9).ComputeTrendsAcrossThreeErasofMachineLearning.arXiv:https://arxiv.org/abs/2202.05924195.AIandCompute.(2018,May16).OpenAI:https://openai.com/blog/ai-and-compute/196.Loten,A.(2022,August23).AIStartupAnyscaleAdds$99MilliontoAndreessenHorowitz-LedFundingRound.TheWallStreetJournal:https://www.wsj.com/articles/ai-startup-anyscale-adds-99-million-to-andressen-horowitz-led-funding-round-11661254200197.Lynley,M.(2022,December31).ChatGPTgotallthebuzz,butbeneathitisa$1Bdeveloperframeworkthat’squietlyfuelingtheneweraoflifelikeAIandOpenAIandbeyond.BusinessInsider:https://www.businessinsider.com/openai-chatgpt-trained-on-anyscale-ray-generative-lifelike-ai-models-2022-12198.Zhang,Z.,Stoica,I.,etal.(2022,October19).FourReasonsWhyLeadingCompaniesAreBettingOnRay.Anyscale.com:https://www.anyscale.com/blog/four-reasons-why-leading-companies-are-betting-on-ray199.Chu,L.,Reiss,F.,etal.(2022,August23).IBMResearchunveilstwokeyadvancesforfoundationmodels.IBMResearch:https://research.ibm.com/blog/ray-summit-codeflare-foundation-models200.Metz,C.(2022,December26).ANewChatBotIsa‘CodeRed’forGoogle’sSearchBusiness.TheNewYorkTimes:https://www.nytimes.com/2022/12/21/technology/ai-chatgpt-google-search.html201.Roose,K.TheBrillianceandWeirdnessofChatGPT.202.MicrosoftDeveloper.(2022,May27).TheFutureofAIDevelopmentTools.YouTube.com:https://www.youtube.com/watch?v=GVf7A_sr3cM203.Takahashi,D.(2022,September23).TheDeanBeat:NvidiaCEOJensenHuangsaysAIwillautopopulatethe3Dimageryofthemetaverse.VentureBeat:https://venturebeat.com/games/the-deanbeat-nvidia-ceo-jensen-huang-says-ai-will-auto-populate-the-3d-imagery-of-the-metaverse/204.Tabachnyk,M.,andNikolov,S.(2022,September6).ML-EnhancedCodeCompletionImprovesDeveloperProductivity.GoogleResearch:https://ai.googleblog.com/2022/07/ml-enhanced-code-completion-improves.html205.Murphy,M.(2022,May9).Whatarefoundationmodels?IBMResearch:https://research.ibm.com/blog/what-are-foundation-models206.Wiggers,K.(2023,March14).OpenAIreleasesGPT-4,amultimodalAIthatitclaimsisstate-of-the-art.TechCrunch:https://techcrunch.com/2023/03/14/openai-releases-gpt-4-ai-that-it-claims-is-state-of-the-art/207.Fitzpatrick,C.(2021,January7).MeettheWinnersoftheHatefulMemesChallenge.DrivenDataLabs:https://drivendata.co/blog/hateful-memes-winners208.Maaten,L.,Misra,I.,etal.(2022,March16).AdvancesinmultimodalunderstandingresearchatMetaAI.MetaAI:https://ai.facebook.com/blog/advances-in-multimodal-understanding-research-at-meta-ai/209.Coldeway,D.(2019,March11).OpenAIshiftsfromnonprofitto‘capped-profit’toattractcapital.TechCrunch:https://techcrunch.com/2019/03/11/openai-shifts-from-nonprofit-to-capped-profit-to-attract-capital/210.Wiggers,K.(2021,November2).GPT-3comestotheenterprisewithMicrosoft’sAzureOpenAIService.VentureBeat:https://venturebeat.com/ai/gpt-3-comes-to-the-enterprise-with-microsofts-azure-openai-service/211.Pilipiszyn,A.(2021,March25).GPT-3PowerstheNextGenerationofApps.OpenAI:https://openai.com/blog/gpt-3-apps/212.Buildnext-genappswithOpenAI’spowerfulmodels.(n.d.).OpenAI:https://openai.com/api/213.Sinha,D.(2022,April15).Top10GPT-3PoweredApplicationstoKnowin2022.AnalyticsInsight:https://www.analyticsinsight.net/top-10-gpt-3-powered-applications-to-know-in-2022/214.Cai,K.(n.d.).The$2BillionEmoji:HuggingFaceWantsToBeLaunchpadForAMachineLearningRevolution.Forbes:https://www.forbes.com/sites/kenrickcai/2022/05/09/the-2-billion-emoji-hugging-face-wants-to-be-launchpad-for-a-machine-learning-revolution/215.Langston,J.(2021,November2).NewAzureOpenAIServicecombinesaccesstopowerfulGPT-3languagemodelswithAzure’senterprisecapabilities.Microsoft:https://blogs.microsoft.com/ai/new-azure-openai-service/216.Joshi,N.(2019,June19).7TypesOfArtificialIntelligence.Forbes:https://www.forbes.com/sites/cognitiveworld/2019/06/19/7-types-of-artificial-intelligence/?sh=6f27cc37233e217.Samuel,S.(2021,September18).AI’sIslamophobiaproblem.Vox:https://www.vox.com/future-perfect/22672414/ai-artificial-intelligence-gpt-3-bias-muslimOurforeverfrontier218.TheAgeofPlastic:FromParkesinetoPollution.(2019,October11).ScienceMuseum:https://www.sciencemuseum.org.uk/objects-and-stories/chemistry/age-plastic-parkesine-pollution219.TheEditorsofEncyclopaediaBritannica.(2022,December12).ManhattanProject.Britannica:https://www.britannica.com/event/Manhattan-ProjectReferences113#TechVisionTechnologyVision2023WhenAtomsmeetBits220.TransistorInvention&History–whenwasthetransistorinvented.(n.d.).ElectronicsNotes:https://www.electronics-notes.com/articles/history/semiconductors/when-was-transistor-invented-history-invention.php221.1953:TransistorizedComputersEmerge.(n.d.).ComputerHistoryMuseum:https://www.computerhistory.org/siliconengine/transistorized-computers-emerge/222.Norman,S.(2020,July14).Skylab:RememberingAmerica’sFirstSpaceStation.Coca-ColaSpaceScienceCenter:https://www.ccssc.org/skylab/223.Chu,Jennifer.(2016,March3).Thebeginningoftheendforencryptionschemes?MITNews:https://news.mit.edu/2016/quantum-computer-end-encryption-schemes-0303224.HumanGenomeProjectFactSheet.(2022,August24).NationalHumanGenomeResearchInstitute:https://www.genome.gov/about-genomics/educational-resources/fact-sheets/human-genome-project225.McElroy,P.(n.d.).Boeingpilotsthebirthofbiofuelforaviation’ssustainablegrowth.Boeing:https://www.boeing.com/features/innovation-quarterly/2019_q3/btj-sustainability.page226.DARPASuccessfullyTransitionsSyntheticBiomanufacturingTechnologiestoSupportNationalSecurityObjectives.(2021,December8).DARPA:https://www.darpa.mil/news-events/2021-12-08227.Jones,N.(2013,May16).GoogleandNASAsnapupquantumcomputer.Nature:https://www.nature.com/articles/nature.2013.12999228.FiftyYearsAfterGoingtotheMoon,GoodyearLookstoSpacetoEnhanceTirePerformance.(2019,July12).Goodyear:https://corporate.goodyear.com/us/en/media/news/fifty-years-after-going-to-the-moon-goodyear-looks-to-space-to-enhance-tire-performance.html229.Ball,P.(2020,December18).Thelightning-fastquestforCOVIDvaccines–andwhatitmeansforotherdiseases.Nature:https://www.nature.com/articles/d41586-020-03626-1230.Larabel,M.(2022,May30).AMD-PoweredFrontierSupercomputerTopsTop500At1.1Exaflops,TopsGreen500Too.Phoronix:https://www.phoronix.com/news/Top500-Green500-Frontier231.Callaway,E.(2022,July28).‘Theentireproteinuniverse’:AIpredictsshapeofnearlyeveryknownprotein.Nature:https://www.nature.com/articles/d41586-022-02083-2232.Mullin,E.(2022,September29).TheEraofFast,CheapGenomeSequencingIsHere.Wired:https://www.wired.com/story/the-era-of-fast-cheap-genome-sequencing-is-here/233.Brooks,H.1994.Therelationshipbetweenscienceandtechnology.BelferCenter:https://www.belfercenter.org/sites/default/files/files/publication/sciencetechnology.pdf234.TransistorInvention&History–whenwasthetransistorinvented.235.1953:TransistorizedComputersEmerge.236.Howell,E.(2020,February10).TheHistoryofRockets.Space:https://www.space.com/29295-rocket-history.html237.ThreeFamousThingsInventedbyAccident–Slinky,SillyPuttyandthePopsicle.(n.d.).TheEnergyCreditUnion:https://theenergycu.com/three-famous-things-invented-by-accident-slinky-silly-putty-and-the-popsicle/238.Zheng,J.(2020,March15).SARS-CoV-2:anEmergingCoronavirusthatCausesaGlobalThreat.NationalLibraryofMedicine:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7098030/239.Cohen,J.(2020,December17).Shotsofhope.Science:https://vis.sciencemag.org/breakthrough2020/#/finalists/2020-breakthrough-of-the-year240.Arnold,C.(2020,July15).HowcomputationalimmunologychangedthefaceofCOVID-19vaccinedevelopment.Nature:https://www.nature.com/articles/d41591-020-00027-9241.Bernardo,T.,Sobkowich,K.,etal.(2021,February9).CollaboratingintheTimeofCOVID-19:TheScopeandScaleofInnovativeResponsestoaGlobalPandemic.NationalLibraryofMedicine:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7879722/242.Bluestein,A.(2012,August28).TomKnight,GodfatherofSyntheticBiology,OnHowToLearnSomethingNew.FastCompany:https://www.fastcompany.com/3000760/tom-knight-godfather-synthetic-biology-how-learn-something-new243.Hammerling,M.,Gottel,N.,etal.(2013,October6).OpenSequenceInitiative:apartsubmissionstandardtocomplementmodernDNAassemblytechniques.MITLibraries:http://oastats.mit.edu/handle/1721.1/81334244.Remmel,A.(2022,September2).Whatexascalecomputingcouldmeanforchemistry.Chemical&EngineeringNews:https://cen.acs.org/physical-chemistry/computational-chemistry/exascale-computing-mean-chemistry/100/i31245.Trader,T.(2021,November24).ThreeChineseExascaleSystemsDetailedatSC21:TwoOperationalandOneDelayed.HPCWire:https://www.hpcwire.com/2021/11/24/three-chinese-exascale-systems-detailed-at-sc21-two-operational-and-one-delayed/246.Remmel,A.Whatexascalecomputingcouldmeanforchemistry.247.Barney,L.(2021,April29).NWChemEx:ComputationalChemistryCodefortheExascaleEra.HPCWire:https://www.hpcwire.com/2021/04/29/nwchemex-computational-chemistry-code-for-the-exascale-era/248.Choi,C.(2021,March2).QuantumComputingMakesInroadsTowardsPharma.IEEESpectrum:https://spectrum.ieee.org/quantum-drug249.Choi,C.(2022,January20).HowQuantumComputersCanMakeBatteriesBetter.IEEESpectrum:https://spectrum.ieee.org/lithium-air-battery-quantum-computing250.Smith,C.(2021,May25).GoingtotheMoonviatheCloud.TheNewYorkTimes:https://www.nytimes.com/2021/05/25/technology/cloud-computing-simulations-startups.html251.Witze,A.(2020,November3).Astronautshaveconductednearly3,000scienceexperimentsaboardtheISS.Nature:https://www.nature.com/articles/d41586-020-03085-8252.Chow,D.(2022,April8).Tocheaplygo:Howfallinglaunchcostsfueledathrivingeconomyinorbit.NBCNews:https://www.nbcnews.com/science/space/space-launch-costs-growing-business-industry-rcna23488253.Space:TheDawnofaNewAge.(2022,May).CitiGPS:https://ir.citi.com/gps/o_tzvWOka8KtDtjaEWqxkaFlSijjTRjTrQv1J5Zpd-qNEd4M3mkhNRA858x6-9WCyx1cO1wh_WU%3D254.Venditti,B.(2022,January27).TheCostofSpaceFlightBeforeandAfterSpaceX.VisualCapitalist:https://www.visualcapitalist.com/the-cost-of-space-flight/255.Chow,D.Tocheaplygo:Howfallinglaunchcostsfueledathrivingeconomyinorbit.References114#TechVisionTechnologyVision2023WhenAtomsmeetBits256.Davenport,C.(2021,April11).Therevolutioninsatellitetechnologymeansthereareswarmsofspacecraftnobiggerthanaloafofbreadinorbit.TheWashingtonPost:https://www.washingtonpost.com/technology/2021/04/06/small-satellites-growth-space/257.Chow,D.Tocheaplygo:Howfallinglaunchcostsfueledathrivingeconomyinorbit.258.Sheetz,M.(2022,January18).Investmentinspacecompanieshitrecord$14.5billionin2021,reportsays.CNBC:https://www.cnbc.com/2022/01/18/space-investing-q4-report-companies-hit-record-14point5-billion-in-2021.html259.Space:TheDawnofaNewAge.260.Mann,A.(2020,May20).SpaceXnowdominatesrocketflight,bringingbigbenefits—andrisks—toNASA.Science:https://www.science.org/content/article/spacex-now-dominates-rocket-flight-bringing-big-benefits-and-risks-nasa261.Titan.(2022):https://titanspace.co/262.Kim,S.(2022,November13).Pharmagoestospace.Chemical&EngineeringNews:https://cen.acs.org/articles/100/i40/Pharma-goes-space-drug-development.html263.TESSExoplanetMission.(2022,October13).NASA:https://www.nasa.gov/tess-transiting-exoplanet-survey-satellite264.TransitingExoplanetSurveySatellite(TESS).(2021,March22).NASA:https://exoplanets.nasa.gov/tess/265.Mehta,J.(2021).TESS,findingnewworlds.ThePlanetarySociety:https://www.planetary.org/space-missions/tess266.JASON-3.(n.d.).NationalOceanic&AtmosphericAdministration:https://www.nesdis.noaa.gov/current-satellite-missions/currently-flying/jason-3267.Uppal,R.(2021,November3).‘Space-as-a-Service’,‘Satellite-as-a-Service’and‘SpaceDataasaService’AreNewBusinessModelsofSpaceIndustry.InternationalDefense,Security&Technology:https://idstch.com/space/space-as-a-service-satellite-as-a-service-and-space-data-as-a-service-are-new-buisness-models-of-space-industry/268.Riolo,J.andSteckl,A.(2022,February18).Comparativeanalysisofgenomecodecomplexityandmanufacturabilitywithengineeringbenchmarks.Nature:https://www.nature.com/articles/s41598-022-06723-5269.Snyder,A.(2022,October2).There’sanewcompetitionforfaster,cheaperDNAsequencing.Axios:https://www.axios.com/2022/09/29/competition-dna-sequencing-illumina270.GeneSynthesisCost.(n.d.).SynbioTechnologies:https://synbio-tech.com/gene-synthesis-cost/271.Lu,Y.(2021,November24).TheGene-SynthesisRevolution.TheNewYorkTimes:https://www.nytimes.com/2021/11/24/magazine/gene-synthesis.html272.GinkgoBioworks:OurPlatform.(2023):https://www.ginkgobioworks.com/our-platform/273.Fitzpatrick,E.(2013).OpenSourceSyntheticBiology:ProblemsandSolutions.SetonHallUniversity:https://scholarship.shu.edu/cgi/viewcontent.cgi?article=1047&context=student_scholarship274.BioBricksBionet.(n.d.):https://biobricks.org/bionet/#275.Rappuoli,R.,Gregorio,E.,etal.(2021,January11).Vaccinologyinthepost-COVID-19era.PNAS:https://www.pnas.org/doi/10.1073/pnas.2020368118276.BoltThreadsMylo.(n.d.):https://boltthreads.com/technology/mylo/277.Candelon,F.,Gombeaud,M.,etal.(2021,August6).Syntheticbiologycouldhelpbusinesssavetheplanet.Fortune:https://fortune.com/2021/08/06/synthetic-biology-plant-based-meats-bioengineering-environmental-impact/278.Arnold,C.HowcomputationalimmunologychangedthefaceofCOVID-19vaccinedevelopment.279.Sweger,Z.(2022,October18).Newengineeredproteinscouldbeusedtodevelopadaptation-proofCOVIDvaccine.PennState:https://www.psu.edu/news/research/story/new-engineered-proteins-could-be-used-develop-adaptation-proof-covid-vaccine/280.Tollefson,J.(2020,August7).Whydeforestationandextinctionsmakepandemicsmorelikely.Nature:https://www.nature.com/articles/d41586-020-02341-1281.QuantumPFASChemicalsRemediation(QPFAS).(n.d.).IrishCentreforHigh-endComputing:https://www.ichec.ie/academic/research/quantum-pfas-chemicals-remediation-qpfas282.LanzaTech.(2022):https://lanzatech.com/283.Specht,L.,andStone,L.(2021,May21).USDAAMSCommentonSupplyChains.GoodFoodInstitute:https://gfi.org/wp-content/uploads/2021/05/Comment-from-the-Good-Food-Institute.pdf284.QuantumInnovationInitiative.(n.d.):https://qii.jp/285.Fein,R.(2022,April11).CollaborationisDominatingQuantumComputing.TheQuantumLeap:https://quantumtech.blog/2022/04/11/collaboration-is-dominating-quantum-computing/286.Codexis:OurPartners.(2023):https://www.codexis.com/partnerships/our-partners287.GinkgoBioworks:TheFutureofFood.(2023):https://www.ginkgobioworks.com/our-ecosystem/the-future-of-food/288.Ramanan,A.(2022,January27).NASA’sJPLusesMicrosoft’sAzureQuantumtomanagecommunicationwithspacemissions.Microsoft:https://cloudblogs.microsoft.com/quantum/2022/01/27/nasas-jpl-uses-microsofts-azure-quantum-to-manage-communication-with-space-missions/289.VolgraffHeidweiller,C.(2022,July19).OurnewQuantumVirtualMachinewillaccelerateresearchandhelppeoplelearnquantumcomputing.Google:https://blog.google/technology/research/our-new-quantum-virtual-machine-will-accelerate-research-and-help-people-learn-quantum-computing/290.Sheetz,M.(2022,November29).AmazonusedAWSonasatelliteinorbittospeedupdataanalysisin‘first-of-itskind’experiment.CNBC:https://www.cnbc.com/2022/11/29/amazon-aws-experiment-satellite-orbit.html291.Sun,T.,Song,J.,etal.(2022,March1).Challengesandrecentprogressinthegovernanceofbiosecurityrisksintheeraofsyntheticbiology.ScienceDirect:https://www.sciencedirect.com/science/article/pii/S2588933822000036292.Xu,T.(2022,September14).Whatarequantum-resistantalgorithms—andwhydoweneedthem?MITTechnologyReview:https://www.technologyreview.com/2022/09/14/1059400/explainer-quantum-resistant-algorithms/293.JPMorganChase,ToshibaandCienaBuildtheFirstQuantumKeyDistributionNetworkUsedtoSecureMission-CriticalBlockchainApplication.(2022,February17).Toshiba:https://news.toshiba.com/press-releases/press-release-details/2022/JPMorgan-Chase-Toshiba-and-Ciena-Build-the-First-Quantum-Key-Distribution-Network-Used-to-Secure-Mission-Critical-Blockchain-Application/default.aspxReferencesAboutAccentureAccentureisaleadingglobalprofessionalservicescompanythathelpstheworld’sleadingbusinesses,governmentsandotherorganizationsbuildtheirdigitalcore,optimizetheiroperations,acceleraterevenuegrowthandenhancecitizenservices—creatingtangiblevalueatspeedandscale.Weareatalentandinnovationledcompanywith738,000peopleservingclientsinmorethan120countries.Technologyisatthecoreofchangetoday,andweareoneoftheworld’sleadersinhelpingdrivethatchange,withstrongecosystemrelationshaips.Wecombineourstrengthintechnologywithunmatchedindustryexperience,functionalexpertiseandglobaldeliverycapability.Weareuniquelyabletodelivertangibleoutcomesbecauseofourbroadrangeofservices,solutionsandassetsacrossStrategy&Consulting,Technology,Operations,IndustryXandAccentureSong.Thesecapabilities,togetherwithourcultureofsharedsuccessandcommitmenttocreating360°value,enableustohelpourclientssucceedandbuildtrusted,lastingrelationships.Wemeasureoursuccessbythe360°valuewecreateforourclients,eachother,ourshareholders,partnersandcommunities.Visitusatwww.accenture.com.AboutAccentureLabsAccentureLabsincubatesandprototypesnewconceptsthroughappliedR&Dprojectsthatareexpectedtohaveasignificantimpactonbusinessandsociety.Ourdedicatedteamoftechnologistsandresearchersworkwithleadersacrossthecompanyandexternalpartnerstoimagineandinventthefuture.AccentureLabsislocatedinsevenkeyresearchhubsaroundtheworld:SanFrancisco,CA;Washington,D.C.;Dublin,Ireland;SophiaAntipolis,France;Herzliya,Israel;Bangalore,India;Shenzhen,ChinaandNanoLabsacrosstheglobe.Formoreinformation,pleasevisitwww.accenture.com/labs.Disclaimer:Thematerialinthisdocumentreflectsinformationavailableatthepointintimeatwhichthisdocumentwaspreparedasindicatedbythedateprovidedonthefrontpage,howevertheglobalsituationisrapidlyevolvingandthepositionmaychange.Thiscontentisprovidedforgeneralinformationpurposesonly,doesnottakeintoaccountthereader’sspecificcircumstances,andisnotintendedtobeusedinplaceofconsultationwithourprofessionaladvisors.Accenturedisclaims,tothefullestextentpermittedbyapplicablelaw,anyandallliabilityfortheaccuracyandcompletenessoftheinformationinthisdocumentandforanyactsoromissionsmadebasedonsuchinformation.Accenturedoesnotprovidelegal,regulatory,audit,ortaxadvice.Readersareresponsibleforobtainingsuchadvicefromtheirownlegalcounselorotherlicensedprofessionals.Thisdocumentreferstomarksownedbythirdparties.Allsuchthird-partymarksarethepropertyoftheirrespectiveowners.Nosponsorship,endorsementorapprovalofthiscontentbytheownersofsuchmarksisintended,expressedorimplied.Copyright©2023Accenture.Allrightsreserved.AccentureanditslogoareregisteredtrademarksofAccenture.#TechVisionAccentureResearchAccentureResearchcreatesthoughtleadershipaboutthemostpressingbusinessissuesorganizationsface.Combininginnovativeresearchtechniques,suchasdatascienceledanalysis,withadeepunderstandingofindustryandtechnology,ourteamof300researchersin20countriespublishhundredsofreports,articles,andpointsofvieweveryyear.Ourthought-provokingresearchdevelopedwithworldleadingorganizationshelpsourclientsembracechange,createvalue,anddeliveronthepoweroftechnologyandhumaningenuity.Formoreinformation,visitwww.accenture.com/research.

1、当您付费下载文档后，您只拥有了使用权限，并不意味着购买了版权，文档只能用于自身使用，不得用于其他商业用途（如 [转卖]进行直接盈利或[编辑后售卖]进行间接盈利）。
2、本站所有内容均由合作方或网友上传，本站不对文档的完整性、权威性及其观点立场正确性做任何保证或承诺！文档内容仅供研究参考，付费前请自行鉴别。
3、如文档内容存在违规，或者侵犯商业秘密、侵犯著作权等，请点击“违规举报”。

碎片内容

碳中和的最新文档